{"title":"Mini Designs","description":"\u003cdiv style=\"text-align: center;\"\u003e\u003cstrong\u003eHere you will find Mini Embroidery Designs in fill, sketch, and vintage stitch. \u003c\/strong\u003e\u003c\/div\u003e\n\u003cdiv style=\"text-align: center;\"\u003e\u003cstrong\u003eAlso, any available larger sizes to mini designs\u003c\/strong\u003e\u003c\/div\u003e","products":[{"product_id":"egg-trio-mini-fill-1-25-1-5-and-1-75-inch","title":"Easter Egg Trio Mini","description":"\u003cp\u003eOur adorable Egg Trio with Bows are a perfect accent to names or monograms.  Hand-drawn and digitized in a fill stitch.  There are three sizes to this trio design: 1.25 inch, 1.5 inch, and 1.75 inches high.  Perfect for adding to your Easter or spring designs such as monograms, names, and even favorite cocktail napkins to spruce up your bar cart. These work great with soft or pastel colored threads for the eggs with a darker contrasting thread for the motif bow. Each size has been tested for quality stitching.\u003c\/p\u003e\n\u003cp\u003eTHIS IS A DIGITAL PRODUCT. You must own an embroidery machine and know how to unzip your files and transfer them to your machine in order for the design\/s to stitch out. This is NOT a finished product.\u003c\/p\u003e\n\u003cp\u003e\u003cspan\u003eThis file comes in the following formats: PES, DST, HUS, JEF, EXP, XXX, VP3, BMP, and INF.\u003c\/span\u003e\u003c\/p\u003e\n\u003cp\u003e*Fonts or additional designs pictured are not included*\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eBy purchasing this listing, you are agreeing to the following terms: \u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eThis is a DIGITAL embroidery design available for immediate download intended for use with an embroidery\/applique machine. This is not a patch.\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eDue to the digital nature and instant downloads of purchased items; returns, refunds, exchanges or cancellations are not available. \u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eFor best results, resizing is not recommended. We cannot guarantee results when a design has been modified in a software or when using non-traditional hooping methods. \u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eYou may not copy, share, or sell my digital designs in part or entirety. Resale of physical merchandise created by using this\/these designs is permitted. \u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eIf there is a problem with an item you downloaded, please let me know right away and I will do my best to fix it.\u003c\/p\u003e\n\u003cp\u003e\u003cbr\u003e**If you forget to use a sale or coupon code, I am not able to issue a refund for the discount.\u003cbr\u003e\u003cbr\u003e\u003c\/p\u003e","brand":"MKB Embroidery Designs","offers":[{"title":"Default Title","offer_id":46691375841565,"sku":null,"price":3.75,"currency_code":"USD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0828\/0562\/1021\/files\/eastereggtriominimerrybeeImage.png?v=1695910945"},{"product_id":"coneflower-daisy-wildflower-embellishment","title":"Coneflower Daisy Wildflower Machine Embroidery Design File","description":"\u003cp\u003eThe Coneflower Daisy Wildflower embellishment makes for a great spring or summer embroidery design.  It does well as a stand alone design and adds a classic and timeless accent for monograms. Hand-drawn and digitized with a satin and french knot stitch, it adds a traditional touch to monograms.  The design comes in three sizes: 2.5 inch, 3 inch, and 3.5 inches wide. Each size has been tested for quality stitching. This design is perfect for clothing, tote bags, table linens, zip bags, baby nursery accents, pillow shams, and more!  \u003c\/p\u003e\n\u003cp\u003eWHAT'S INCLUDED:\u003cbr\u003e◾ Coneflower Satin Stitch Machine Embroidery Design includes the following sizes:\u003cbr\u003e2.5\" (3249 Stitches)\u003cbr\u003e3\" (4117 Stitches)\u003cbr\u003e3.5\" (4139 Stitches)\u003cbr\u003e◾ This digital file comes in a .zip file downloadable format that includes: PES, HUS, JEF, EXP, XXX, VP3, and DST.\u003c\/p\u003e\n\u003cp\u003eTHIS IS A DIGITAL PRODUCT. You must own an embroidery machine and know how to unzip your files and transfer them to your machine in order for the design\/s to stitch out. This is NOT a finished product.\u003c\/p\u003e\n\u003cp\u003e\u003cbr data-mce-fragment=\"1\"\u003e*Fonts or additional designs pictured are not included*\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eBy purchasing this listing, you are agreeing to the following terms: \u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eThis is a DIGITAL embroidery design available for immediate download intended for use with an embroidery\/applique machine. This is not a patch.\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eDue to the digital nature and instant downloads of purchased items; returns, refunds, exchanges or cancellations are not available. \u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eFor best results, resizing is not recommended. We cannot guarantee results when a design has been modified in a software or when using non-traditional hooping methods. \u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eYou may not copy, share, or sell my digital designs in part or entirety. Resale of physical merchandise created by using this\/these designs is permitted. \u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eIf there is a problem with an item you downloaded, please let me know right away and I will do my best to fix it.\u003c\/p\u003e\n\u003cp\u003e\u003cbr\u003e**If you forget to use a sale or coupon code, I am not able to issue a refund for the discount.\u003cbr\u003e\u003cbr\u003e\u003c\/p\u003e","brand":"MKB Embroidery Designs","offers":[{"title":"Default Title","offer_id":46691388424477,"sku":null,"price":3.75,"currency_code":"USD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0828\/0562\/1021\/files\/coneflowersimplyyoursImage_2.png?v=1711120069"},{"product_id":"wooden-lake-boat-embellishment","title":"Wooden Lake Boat Mini","description":"\u003cp\u003eThe Wooden Lake Boat embellishment is a perfect add-on to a monogram or name and even works great as a stand alone design. \u003cspan data-mce-fragment=\"1\"\u003eHand-drawn and digitized with a \u003c\/span\u003e\u003cspan data-mce-fragment=\"1\"\u003efill\u003c\/span\u003e\u003cspan data-mce-fragment=\"1\"\u003e stitch, it adds a traditional touch to monograms. \u003c\/span\u003e Use this mini fill stitch design to \u003cspan data-mce-fragment=\"1\"\u003eembellish garments such as golf shirts, pullovers, dresses, t-shirts, and onesies. The embroidery design also works great on tote bags, dish towels, napkins, cocktail napkins, table linens, and more. \u003c\/span\u003eThe design comes in three sizes: 2 inch, 2.5 inch, and 3 inches wide. Each size has been tested for quality stitching. \u003cspan data-mce-fragment=\"1\"\u003ePerfect for summer lake gatherings, parties, July 4th, or summer themed celebrations. \u003c\/span\u003e \u003c\/p\u003e\n\u003cp\u003eTHIS IS A DIGITAL PRODUCT. You must own an embroidery machine and know how to unzip your files and transfer them to your machine in order for the design\/s to stitch out. This is NOT a finished product.\u003c\/p\u003e\n\u003cp\u003e\u003cspan\u003eThis file comes in the following formats: PES, DST, HUS, JEF, EXP, XXX, VP3, BMP, and INF.\u003c\/span\u003e\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003e*Fonts or additional designs pictured are not included*\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eBy purchasing this listing, you are agreeing to the following terms: \u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eThis is a DIGITAL embroidery design available for immediate download intended for use with an embroidery\/applique machine. This is not a patch.\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eDue to the digital nature and instant downloads of purchased items; returns, refunds, exchanges or cancellations are not available. \u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eFor best results, resizing is not recommended. We cannot guarantee results when a design has been modified in a software or when using non-traditional hooping methods. \u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eYou may not copy, share, or sell my digital designs in part or entirety. Resale of physical merchandise created by using this\/these designs is permitted. \u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eIf there is a problem with an item you downloaded, please let me know right away and I will do my best to fix it.\u003c\/p\u003e\n\u003cp\u003e\u003cbr\u003e**If you forget to use a sale or coupon code, I am not able to issue a refund for the discount.\u003cbr\u003e\u003cbr\u003e\u003c\/p\u003e","brand":"MKB Embroidery Designs","offers":[{"title":"Default Title","offer_id":46691390062877,"sku":null,"price":3.75,"currency_code":"USD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0828\/0562\/1021\/files\/woodenlakeboatsimplyyoursImage.png?v=1695992673"},{"product_id":"american-flags-embroidery-design","title":"American Flags Crossed Mini Bean Stitch Embroidery Design","description":"\u003cp\u003eThe Two Crossed \u003cspan data-mce-fragment=\"1\"\u003eAmerican Flags bean stitch embroidery design\u003c\/span\u003e is a great add-on to patriotic embroidery projects.  It does well as a stand alone design and adds a classic and timeless accent for monograms. Hand-drawn and digitized with a bean stitch and motif design; the USA flags come in three sizes: 1.25 inch, 2 inch, and 2.5 inches wide. Each size has been tested for quality stitching. \u003cspan data-mce-fragment=\"1\"\u003eUse this mini motif bean stitch American flag embroidery design to embellish garments tote bags, cocktail napkins, table linens, zip bags, and more. Perfect for patriotic gatherings, parties, 4th of July, summer monograms, patriotic monograms, or summer themed celebrations.\u003c\/span\u003e\u003c\/p\u003e\n\u003cp\u003eTHIS IS A DIGITAL PRODUCT. You must own an embroidery machine and know how to unzip your files and transfer them to your machine in order for the design\/s to stitch out. This is NOT a finished product.\u003c\/p\u003e\n\u003cp\u003eWHAT'S INCLUDED:\u003cbr\u003e◾Mini American Flags Bean Stitch Machine Embroidery Design includes the following sizes:\u003cbr\u003e 1.25\" (953 Stitches)\u003cbr\u003e 2\" (1260 Stitches)\u003cbr\u003e 2.5\" (1479 Stitches)\u003cbr\u003e◾ This digital file comes in a .zip file downloadable format that includes: PES, HUS, JEF, EXP, XXX, VP3, and DST.\u003c\/p\u003e\n\u003cp\u003e\u003cbr data-mce-fragment=\"1\"\u003e*Fonts or additional designs pictured are not included*\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eBy purchasing this listing, you are agreeing to the following terms: \u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eThis is a DIGITAL embroidery design available for immediate download intended for use with an embroidery\/applique machine. This is not a patch.\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eDue to the digital nature and instant downloads of purchased items; returns, refunds, exchanges or cancellations are not available. \u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eFor best results, resizing is not recommended. We cannot guarantee results when a design has been modified in a software or when using non-traditional hooping methods. \u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eYou may not copy, share, or sell my digital designs in part or entirety. Resale of physical merchandise created by using this\/these designs is permitted up to 49 times.  Commercial license listing is required for embroidering on 50+ items. \u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eIf there is a problem with an item you downloaded, please let me know right away and I will do my best to fix it.\u003c\/p\u003e\n\u003cp\u003e\u003cbr\u003e**If you forget to use a sale or coupon code, I am not able to issue a refund for the discount.\u003cbr\u003e\u003cbr\u003e\u003c\/p\u003e","brand":"MKB Embroidery Designs","offers":[{"title":"Default Title","offer_id":46691390849309,"sku":null,"price":4.0,"currency_code":"USD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0828\/0562\/1021\/files\/american_flags_crossed_wedowee_image.png?v=1738469232"},{"product_id":"off-road-vintage-4x4-truck-mini","title":"Off Road Vintage 4x4 Truck Mini Fill Stitch","description":"\u003cp\u003eOur \u003cspan data-mce-fragment=\"1\"\u003eVintage 4x4 Off Road mini\u003c\/span\u003e embroidery design is the perfect add-on to a monogram or name. \u003cspan data-mce-fragment=\"1\"\u003eHand-drawn and digitized with a fill stitch, it adds a classic touch to embroidery projects on golf shirts, t-shirts, onesies, zip bags, tote bags, and more. Perfect for birthdays, beach trips, summer fun, or any vintage themed festivities. This design also comes in other styles in different listings. This Vintage 4x4 Truck Mini Fill Machine Embroidery Design includes three sizes.\u003c\/span\u003e\u003cspan data-mce-fragment=\"1\"\u003e \u003c\/span\u003eEach size has been tested for quality stitching. \u003cbr\u003e\u003c\/p\u003e\n\u003cp\u003eTHIS IS A DIGITAL PRODUCT. You must own an embroidery machine and know how to unzip your files and transfer them to your machine in order for the design\/s to stitch out. This is NOT a finished product.\u003c\/p\u003e\n\u003cp\u003e\u003cspan\u003eThis file comes in the following formats: PES, DST, HUS, JEF, EXP, XXX, VP3, BMP, and INF.\u003c\/span\u003e\u003c\/p\u003e\n\u003cp\u003e\u003cbr data-mce-fragment=\"1\"\u003e*Fonts or additional designs pictured are not included*\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eBy purchasing this listing, you are agreeing to the following terms: \u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eThis is a DIGITAL embroidery design available for immediate download intended for use with an embroidery\/applique machine. This is not a patch.\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eDue to the digital nature and instant downloads of purchased items; returns, refunds, exchanges or cancellations are not available. \u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eFor best results, resizing is not recommended. We cannot guarantee results when a design has been modified in a software or when using non-traditional hooping methods. \u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eYou may not copy, share, or sell my digital designs in part or entirety. Resale of physical merchandise created by using this\/these designs is permitted up to 49 times. Commercial license listing is required for embroidering on 50+ items. \u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eIf there is a problem with an item you downloaded, please let me know right away and I will do my best to fix it.\u003c\/p\u003e\n\u003cp\u003e\u003cbr\u003e**If you forget to use a sale or coupon code, I am not able to issue a refund for the discount.\u003cbr\u003e\u003cbr\u003e\u003c\/p\u003e","brand":"MKB Embroidery Designs","offers":[{"title":"Default Title","offer_id":46691392979229,"sku":null,"price":3.75,"currency_code":"USD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0828\/0562\/1021\/files\/4x4minisubtlysouthernImage_2.png?v=1709084747"},{"product_id":"mini-pumpkin-with-bow","title":"Pumpkin with Bow Mini Machine Embroidery Design File","description":"\u003cp data-pm-slice=\"1 1 []\"\u003eThe mini pumpkin with a bow is a three color fill stitch embroidery design. Use this cute mini pumpkin embroidery design to embellish garments such as t-shirts, bodysuits, tees, sweatshirts, dresses, golf shirts, and more. The fall embroidery design also works great on tote bags, zip bags, and other accessories.  Perfect for Fall, Autumn, Thanksgiving, or Halloween themed celebrations. Each design has been tested for quality stitching.\u003cbr\u003e\u003c\/p\u003e\n\u003cp data-pm-slice=\"1 1 []\"\u003eWHAT'S INCLUDED:\u003cbr\u003e◾ Pumpkin Bow Mini Fill Stitch Machine Embroidery Design includes the following sizes:\u003cbr\u003e      1 inch (1690 Stitches)\u003cbr\u003e      1.25 inch (2366 Stitches)\u003cbr\u003e      1.5 inch (3071 Stitches)\u003cbr\u003e      1.75 inch (3914 Stitches)\u003cbr\u003e      2 inch (4910 Stitches\u003cbr\u003e      2.25 inch (6055 Stitches)\u003cbr\u003e◾ This digital file comes in a .zip file downloadable format that includes:  PES, HUS, JEF, EXP, XXX, VP3, and DST.\u003c\/p\u003e\n\u003cp\u003eTHIS IS A DIGITAL PRODUCT. You must own an embroidery machine and know how to unzip your files and transfer them to your machine in order for the design\/s to stitch out. This is NOT a finished product.\u003c\/p\u003e\n\u003cp\u003e*Fonts or additional designs pictured are not included*\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eBy purchasing this listing, you are agreeing to the following terms: \u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eThis is a DIGITAL embroidery design available for immediate download intended for use with an embroidery\/applique machine. This is not a patch.\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eDue to the digital nature and instant downloads of purchased items; returns, refunds, exchanges or cancellations are not available. \u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eFor best results, resizing is not recommended. We cannot guarantee results when a design has been modified in a software or when using non-traditional hooping methods. \u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eYou may NOT use our testers' sample photos for use in your business marketing.  We DO allow you to use our digital rendering of the design, as long as our watermark is left intact.  \u003cbr\u003e\u003c\/p\u003e\n\u003cp\u003eYou may not copy, share, or sell my digital designs in part or entirety.  Resale of physical merchandise created by using this\/these designs is permitted up to 49 times. Commercial license listing is required for embroidering on 50+ items.\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eIf there is a problem with an item you downloaded, please let me know right away and I will do my best to fix it.\u003c\/p\u003e\n\u003cp\u003e\u003cbr\u003e**If you forget to use a sale or coupon code, I am not able to issue a refund for the discount.\u003cbr\u003e\u003cbr\u003e\u003c\/p\u003e","brand":"MKB Embroidery Designs","offers":[{"title":"Default Title","offer_id":46691397402909,"sku":null,"price":3.5,"currency_code":"USD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0828\/0562\/1021\/files\/pumpkin_bow_mini_1.25_inch_monogram_sample_image.png?v=1723665445"},{"product_id":"mini-pumpkin","title":"Pumpkin Mini Machine Embroidery Design File","description":"\u003cp data-pm-slice=\"1 1 []\"\u003eThe mini pumpkin is a three color mini fill stitch embroidery design. Use this fall pumpkin fill stitch design to embellish garments such as t-shirts, bodysuits, dresses, tees, golf shirts, bloomers, and more. The mini pumpkin embroidery design also works great on tote bags, zip bags, and other accessories.  Perfect for Fall, Autumn, Thanksgiving, or Halloween themed celebrations. Each design has been tested for quality stitching.\u003cbr\u003e\u003c\/p\u003e\n\u003cp data-pm-slice=\"1 1 []\"\u003eWHAT'S INCLUDED:\u003cbr\u003e◾ Pumpkin Mini Fill Stitch Machine Embroidery Design includes the following sizes:\u003cbr\u003e      1 inch (1268 Stitches)\u003cbr\u003e      1.25 inch (1881 Stitches)\u003cbr\u003e      1.5 inch (2410 Stitches)\u003cbr\u003e      1.75 inch (3149 Stitches)\u003cbr\u003e      2 inch (3875 Stitches)\u003cbr\u003e      2.25 inch (4763 Stitches)\u003cbr\u003e◾ This digital file comes in a .zip file downloadable format that includes:  PES, HUS, JEF, EXP, XXX, VP3, and DST.\u003c\/p\u003e\n\u003cp\u003eTHIS IS A DIGITAL PRODUCT. You must own an embroidery machine and know how to unzip your files and transfer them to your machine in order for the design\/s to stitch out. This is NOT a finished product.\u003c\/p\u003e\n\u003cp\u003e*Fonts or additional designs pictured are not included*\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eBy purchasing this listing, you are agreeing to the following terms: \u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eThis is a DIGITAL embroidery design available for immediate download intended for use with an embroidery\/applique machine. This is not a patch.\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eDue to the digital nature and instant downloads of purchased items; returns, refunds, exchanges or cancellations are not available. \u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eFor best results, resizing is not recommended. We cannot guarantee results when a design has been modified in a software or when using non-traditional hooping methods. \u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eYou may NOT use our testers' sample photos for use in your business marketing. We DO allow you to use our digital rendering of the design, as long as our watermark is left intact.  \u003c\/p\u003e\n\u003cp\u003e\u003cbr\u003eYou may not copy, share, or sell my digital designs in part or entirety.  Resale of physical merchandise created by using this\/these designs is permitted up to 49 times. Commercial license listing is required for embroidering on 50+ items. \u003cbr\u003e\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eIf there is a problem with an item you downloaded, please let me know right away and I will do my best to fix it.\u003c\/p\u003e\n\u003cp\u003e\u003cbr\u003e**If you forget to use a sale or coupon code, I am not able to issue a refund for the discount.\u003cbr\u003e\u003cbr\u003e\u003c\/p\u003e","brand":"MKB Embroidery Designs","offers":[{"title":"Default Title","offer_id":46691397533981,"sku":null,"price":3.5,"currency_code":"USD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0828\/0562\/1021\/files\/pumpkin_mini_1.25_inch_monogram_sample_image.png?v=1723667372"},{"product_id":"friendly-ghost-with-bow","title":"Friendly Ghost with Bow Mini","description":"\u003cp data-pm-slice=\"1 1 []\"\u003eOur \u003cspan data-mce-fragment=\"1\"\u003eFriendly Ghost with Bow\u003c\/span\u003e is a cute accent for a name or monogram.  Hand drawn and digitized in a fill stitch.  The design comes in three sizes: 1, 1.5, and 2 inches. \u003cspan data-mce-fragment=\"1\"\u003eUse this mini fill stitch design to embellish garments such as t-shirts, dresses, onesies, pullovers, pencil bags, accessories, and more. Perfect for all the Halloween Festivities! \u003c\/span\u003eEach design has been tested for quality stitching.\u003cbr\u003e\u003c\/p\u003e\n\u003cp\u003eTHIS IS A DIGITAL PRODUCT. You must own an embroidery machine and know how to unzip your files and transfer them to your machine in order for the design\/s to stitch out. This is NOT a finished product.\u003c\/p\u003e\n\u003cp\u003e\u003cspan\u003eThis file comes in the following formats: PES, DST, HUS, JEF, EXP, XXX, VP3, BMP, and INF.\u003c\/span\u003e\u003c\/p\u003e\n\u003cp\u003e*Fonts or additional designs pictured are not included*\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eBy purchasing this listing, you are agreeing to the following terms: \u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eThis is a DIGITAL embroidery design available for immediate download intended for use with an embroidery\/applique machine. This is not a patch.\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eDue to the digital nature and instant downloads of purchased items; returns, refunds, exchanges or cancellations are not available. \u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eFor best results, resizing is not recommended. We cannot guarantee results when a design has been modified in a software or when using non-traditional hooping methods. \u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eYou may not copy, share, or sell my digital designs in part or entirety. Resale of physical merchandise created by using this\/these designs is permitted. \u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eIf there is a problem with an item you downloaded, please let me know right away and I will do my best to fix it.\u003c\/p\u003e\n\u003cp\u003e\u003cbr\u003e**If you forget to use a sale or coupon code, I am not able to issue a refund for the discount.\u003cbr\u003e\u003cbr\u003e\u003c\/p\u003e","brand":"MKB Embroidery Designs","offers":[{"title":"Default Title","offer_id":46691440820509,"sku":null,"price":3.25,"currency_code":"USD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0828\/0562\/1021\/files\/ghostgirlsimplyyours2Image.png?v=1695937472"},{"product_id":"bow-side-bow-mini-embroidery-design","title":"Bow Embroidery Design, Medium Side Bow Satin Stitch","description":"\u003cp\u003eThe medium Side Bow Satin Stitch Embroidery Design adds an adorable accent for monograms or names. \u003cspan data-mce-fragment=\"1\"\u003eThis cute bow embroidery design works great to duplicate for a double bow embellishment. \u003c\/span\u003eHand-drawn and digitized with a satin stitch, it adds a classic touch to embroidery projects.  The embroidery design comes in four larger sizes to cover various embroidery project needs: 1.75 inch, 2 inch, 2.25 inch, and 2.5 inches wide. \u003cspan data-mce-fragment=\"1\"\u003e (copy and paste the design, then mirror to create two bows that flank a name, monogram, or single letter). See our smaller sizes available in a separate listing. \u003c\/span\u003eEach size has been tested for quality stitching. \u003c\/p\u003e\n\u003cp\u003eTHIS IS A DIGITAL PRODUCT. You must own an embroidery machine and know how to unzip your files and transfer them to your machine in order for the design\/s to stitch out. This is NOT a finished product.\u003c\/p\u003e\n\u003cp\u003eWHAT'S INCLUDED:\u003cbr\u003e◾ Side Bow Satin Stitch Machine Embroidery Design includes the following sizes:\u003cbr\u003e 1.75 inch (1363 stitches)\u003cbr\u003e 2 inch (1588 stitches)\u003cbr\u003e 2.25 inch (1783 stitches)\u003cbr\u003e 2.5 inch (1973 stitches)\u003cbr\u003e◾ This digital file comes in a .zip file downloadable format that includes: PES, HUS, JEF, EXP, XXX, VP3, and DST.\u003c\/p\u003e\n\u003cp\u003e*Fonts or additional designs pictured are not included*\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eBy purchasing this listing, you are agreeing to the following terms: \u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eThis is a DIGITAL embroidery design available for immediate download intended for use with an embroidery\/applique machine. This is not a patch.\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eDue to the digital nature and instant downloads of purchased items; returns, refunds, exchanges or cancellations are not available. \u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eFor best results, resizing is not recommended. We cannot guarantee results when a design has been modified in a software or when using non-traditional hooping methods. \u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eYou may not copy, share, or sell my digital designs in part or entirety. Resale of physical merchandise created by using this\/these designs is permitted up to 49 times.  Commercial license listing is required for embroidering on 50+ items. \u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eIf there is a problem with an item you downloaded, please let me know right away and I will do my best to fix it.\u003c\/p\u003e\n\u003cp\u003e\u003cbr\u003e**If you forget to use a sale or coupon code, I am not able to issue a refund for the discount.\u003cbr\u003e\u003cbr\u003e\u003c\/p\u003e","brand":"MKB Embroidery Designs","offers":[{"title":"Default Title","offer_id":46691445145885,"sku":null,"price":3.25,"currency_code":"USD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0828\/0562\/1021\/files\/sidebowsImage.png?v=1695852320"},{"product_id":"bow-side-bow-embroidery-design-mini","title":"Bow Embroidery Design, Mini Side Bow Satin Stitch","description":"\u003cp\u003eThe Mini Side Bow Satin Stitch Embroidery Design adds an adorable accent for monograms or names. \u003cspan data-mce-fragment=\"1\"\u003eThis cute embroidery design works great to duplicate for a double bow embellishment. \u003c\/span\u003eHand-drawn and digitized with a satin stitch, it adds a classic touch to embroidery projects.  The design comes in four smaller sizes to cover various embroidery project needs: .75 inch, 1 inch, 1.25 inch, and 1.5 inches wide. \u003cspan data-mce-fragment=\"1\"\u003e Copy and paste the design, then mirror to create two bows that flank a name, monogram, or single letter. See our larger sizes available in a separate listing. \u003c\/span\u003eEach size has been tested for quality stitching. \u003c\/p\u003e\n\u003cp\u003eTHIS IS A DIGITAL PRODUCT. You must own an embroidery machine and know how to unzip your files and transfer them to your machine in order for the design\/s to stitch out. This is NOT a finished product.\u003c\/p\u003e\n\u003cp\u003eWHAT'S INCLUDED:\u003cbr\u003e◾ Side Bow Mini Satin Stitch Machine Embroidery Design includes the following sizes:\u003cbr\u003e .75 inch (610 stitches)\u003cbr\u003e 1 inch (741 stitches)\u003cbr\u003e 1.25 inch (911 stitches)\u003cbr\u003e 1.5 inch (1082 stitches)\u003cbr\u003e◾ This digital file comes in a .zip file downloadable format that includes: PES, HUS, JEF, EXP, XXX, VP3, and DST.\u003c\/p\u003e\n\u003cp\u003e\u003cbr data-mce-fragment=\"1\"\u003e*Fonts or additional designs pictured are not included*\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eBy purchasing this listing, you are agreeing to the following terms: \u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eThis is a DIGITAL embroidery design available for immediate download intended for use with an embroidery\/applique machine. This is not a patch.\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eDue to the digital nature and instant downloads of purchased items; returns, refunds, exchanges or cancellations are not available. \u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eFor best results, resizing is not recommended. We cannot guarantee results when a design has been modified in a software or when using non-traditional hooping methods. \u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eYou may not copy, share, or sell my digital designs in part or entirety. Resale of physical merchandise created by using this\/these designs is permitted up to 49 times.  Commercial license listing is required for embroidering on 50+ items. \u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eIf there is a problem with an item you downloaded, please let me know right away and I will do my best to fix it.\u003c\/p\u003e\n\u003cp\u003e\u003cbr\u003e**If you forget to use a sale or coupon code, I am not able to issue a refund for the discount.\u003cbr\u003e\u003cbr\u003e\u003c\/p\u003e","brand":"MKB Embroidery Designs","offers":[{"title":"Default Title","offer_id":46691446063389,"sku":null,"price":3.25,"currency_code":"USD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0828\/0562\/1021\/files\/sidebowsminiImage.png?v=1695853108"},{"product_id":"tote-bag-with-bow","title":"Tote Bag with Bow Mini","description":"\u003cp\u003e\u003cspan data-mce-fragment=\"1\"\u003eThe Tote Bag\u003c\/span\u003e with Bow Design\u003cspan data-mce-fragment=\"1\"\u003e is perfect for all your fun summer gatherings, bridal parties, girls trip, beach or lake parties, and more.\u003c\/span\u003e  The design adds a fun accent for monograms or as a stand alone embellishment. Hand-drawn and digitized with a fill stitch, the design comes in three sizes: 1 inch, 1.5 inch, and 2 inches. Each size has been tested for quality stitching. This design is perfect for cocktail napkins or coasters, guest towels, clothing, tote bags, table linens, zip bags, and more!  \u003cbr\u003e\u003c\/p\u003e\n\u003cp\u003eTHIS IS A DIGITAL PRODUCT. You must own an embroidery machine and know how to unzip your files and transfer them to your machine in order for the design\/s to stitch out. This is NOT a finished product.\u003c\/p\u003e\n\u003cp\u003e\u003cspan\u003eThis file comes in the following formats: PES, DST, HUS, JEF, EXP, XXX, VP3, BMP, and INF.\u003c\/span\u003e\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003e*Fonts or additional designs pictured are not included*\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eBy purchasing this listing, you are agreeing to the following terms: \u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eThis is a DIGITAL embroidery design available for immediate download intended for use with an embroidery\/applique machine. This is not a patch.\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eDue to the digital nature and instant downloads of purchased items; returns, refunds, exchanges or cancellations are not available. \u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eFor best results, resizing is not recommended. We cannot guarantee results when a design has been modified in a software or when using non-traditional hooping methods. \u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eYou may not copy, share, or sell my digital designs in part or entirety. Resale of physical merchandise created by using this\/these designs is permitted. \u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eIf there is a problem with an item you downloaded, please let me know right away and I will do my best to fix it.\u003c\/p\u003e\n\u003cp\u003e\u003cbr\u003e**If you forget to use a sale or coupon code, I am not able to issue a refund for the discount.\u003cbr\u003e\u003cbr\u003e\u003c\/p\u003e","brand":"MKB Embroidery Designs","offers":[{"title":"Default Title","offer_id":46691459662109,"sku":null,"price":4.0,"currency_code":"USD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0828\/0562\/1021\/files\/totebagwithbowmkbImage.png?v=1695956216"},{"product_id":"turkey-football-pie-mini-1-embroidery-design","title":"Turkey Football Pie Mini Fill Stitch Embroidery Design","description":"\u003cp\u003eOur Mini Turkey Football Pie Machine Fill Stitch Embroidery Design is a fun mash-up for all things Fall season and a perfect add-on to a monogram. \u003cspan data-mce-fragment=\"1\"\u003eHand-drawn and digitized with a fill stitch, the design comes in three sizes: 1 inch, 1.25 inch, and 1.5 inches. Each size includes a one color pie for a quick stitch and a two color pie option.  Each size has been tested for quality stitching.  \u003c\/span\u003eUse this mini Turkey Football Pie fill stitch embroidery design to embellish garments such as t-shirts, golf shirts, tees, sweatshirts, onesies, and more. The embroidery design also works great on tote bags, zip bags, linens, Thanksgiving monograms, and other accessories. Perfect for football games, tailgating parties, Football monograms, Thanksgiving monograms, hostess gifts, Superbowl parties, Fall festivities, or any football themed celebration. \u003c\/p\u003e\n\u003cp\u003eTHIS IS A DIGITAL PRODUCT. You must own an embroidery machine and know how to unzip your files and transfer them to your machine in order for the design\/s to stitch out. This is NOT a finished product.\u003c\/p\u003e\n\u003cp\u003eWHAT'S INCLUDED:\u003cbr data-mce-fragment=\"1\"\u003e◾ Mini Turkey Football Pie Machine Embroidery Design in both a 1 color and 2 color pie:\u003cbr data-mce-fragment=\"1\"\u003e 1\" (1311 Stitches)\u003cbr data-mce-fragment=\"1\"\u003e 1.25\" (1807 Stitches)\u003cbr data-mce-fragment=\"1\"\u003e 1.5\" (2326 Stitches)\u003cbr data-mce-fragment=\"1\"\u003e◾ This digital file comes in a .zip file downloadable format that includes: PES, HUS, JEF, EXP, XXX, VP3, and DST.\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003e*Fonts or additional designs pictured are not included*\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eBy purchasing this listing, you are agreeing to the following terms: \u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eThis is a DIGITAL embroidery design available for immediate download intended for use with an embroidery\/applique machine. This is not a patch.\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eDue to the digital nature and instant downloads of purchased items; returns, refunds, exchanges or cancellations are not available. \u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eFor best results, resizing is not recommended. We cannot guarantee results when a design has been modified in a software or when using non-traditional hooping methods. \u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eYou may not copy, share, or sell my digital designs in part or entirety. Resale of physical merchandise created by using this\/these designs is permitted up to 49 times.   Commercial license listing is required for embroidering on 50+ items. \u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eIf there is a problem with an item you downloaded, please let me know right away and I will do my best to fix it.\u003c\/p\u003e\n\u003cp\u003e\u003cbr\u003e**If you forget to use a sale or coupon code, I am not able to issue a refund for the discount.\u003cbr\u003e\u003cbr\u003e\u003c\/p\u003e","brand":"MKB Embroidery Designs","offers":[{"title":"Default Title","offer_id":46691461595421,"sku":null,"price":4.0,"currency_code":"USD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0828\/0562\/1021\/files\/TFPMinisubtlysouthernImage.png?v=1695957982"},{"product_id":"christmas-holly-and-leaf-mini","title":"Holly and Berry Mini","description":"\u003cp data-pm-slice=\"1 1 []\"\u003eOur Mini Holly Leaf and Berries is a perfect accent for a name or monogram.  Hand drawn and digitized in a satin stitch.  The design comes in three sizes: 1, 1.25, and 1.5 inch. \u003cspan data-mce-fragment=\"1\"\u003eUse this festive mini satin stitch embroidery design to embellish garments such as t-shirts, dresses, collars, onesies, pullovers, linens, accessories, and more. Perfect for Christmas and holiday festivities, or any winter themed monograms. \u003c\/span\u003e Each design has been tested for quality stitching.\u003c\/p\u003e\n\u003cp\u003eTHIS IS A DIGITAL PRODUCT. You must own an embroidery machine and know how to unzip your files and transfer them to your machine in order for the design\/s to stitch out. This is NOT a finished product.\u003c\/p\u003e\n\u003cp\u003e\u003cspan\u003eThis file comes in the following formats: PES, DST, HUS, JEF, EXP, XXX, VP3, BMP, and INF.\u003c\/span\u003e\u003c\/p\u003e\n\u003cp\u003e*Fonts or additional designs pictured are not included*\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eBy purchasing this listing, you are agreeing to the following terms: \u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eThis is a DIGITAL embroidery design available for immediate download intended for use with an embroidery\/applique machine. This is not a patch.\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eDue to the digital nature and instant downloads of purchased items; returns, refunds, exchanges or cancellations are not available. \u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eFor best results, resizing is not recommended. We cannot guarantee results when a design has been modified in a software or when using non-traditional hooping methods. \u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eYou may not copy, share, or sell my digital designs in part or entirety. \u003cspan data-mce-fragment=\"1\"\u003eResale of physical merchandise created by using this\/these designs is permitted up to 49 times.  Commercial license listing is required for embroidering on 50+ items. \u003c\/span\u003e\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eIf there is a problem with an item you downloaded, please let me know right away and I will do my best to fix it.\u003c\/p\u003e\n\u003cp\u003e\u003cbr\u003e**If you forget to use a sale or coupon code, I am not able to issue a refund for the discount.\u003cbr\u003e\u003cbr\u003e\u003c\/p\u003e","brand":"MKB Embroidery Designs","offers":[{"title":"Default Title","offer_id":46691470934301,"sku":null,"price":3.0,"currency_code":"USD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0828\/0562\/1021\/files\/hollyandberryminisocialgracesImage.png?v=1695868895"},{"product_id":"present-with-a-bow","title":"Christmas Present with a Bow Embroidery Design, Mini","description":"\u003cp data-pm-slice=\"1 1 []\"\u003eOur Mini Present with a Bow is a perfect accent for a name or monogram.  Hand drawn and digitized in a fill stitch.  The design comes in three sizes: 1, 1.5, and 2 inch. Each size includes a single or two color bow option. \u003cspan data-mce-fragment=\"1\"\u003eUse this mini embroidery design to embellish garments such as t-shirts, dresses, collars, onesies, pullovers, linens, accessories, and more. Perfect for birthday, baby shower, Christmas and holiday festivities, or any celebration themed monograms. Each\u003c\/span\u003e design has been tested for quality stitching.\u003c\/p\u003e\n\u003cp\u003eTHIS IS A DIGITAL PRODUCT. You must own an embroidery machine and know how to unzip your files and transfer them to your machine in order for the design\/s to stitch out. This is NOT a finished product.\u003c\/p\u003e\n\u003cp\u003e\u003cspan\u003eThis file comes in the following formats: PES, DST, HUS, JEF, EXP, XXX, VP3, BMP, and INF.\u003c\/span\u003e\u003c\/p\u003e\n\u003cp\u003e*Fonts or additional designs pictured are not included*\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eBy purchasing this listing, you are agreeing to the following terms: \u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eThis is a DIGITAL embroidery design available for immediate download intended for use with an embroidery\/applique machine. This is not a patch.\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eDue to the digital nature and instant downloads of purchased items; returns, refunds, exchanges or cancellations are not available. \u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eFor best results, resizing is not recommended. We cannot guarantee results when a design has been modified in a software or when using non-traditional hooping methods. \u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eYou may not copy, share, or sell my digital designs in part or entirety. \u003cspan data-mce-fragment=\"1\"\u003eResale of physical merchandise created by using this\/these designs is permitted up to 49 times.  Commercial license listing is required for embroidering on 50+ items. \u003c\/span\u003e\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eIf there is a problem with an item you downloaded, please let me know right away and I will do my best to fix it.\u003c\/p\u003e\n\u003cp\u003e\u003cbr\u003e**If you forget to use a sale or coupon code, I am not able to issue a refund for the discount.\u003cbr\u003e\u003cbr\u003e\u003c\/p\u003e","brand":"MKB Embroidery Designs","offers":[{"title":"Default Title","offer_id":46691472933149,"sku":null,"price":3.5,"currency_code":"USD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0828\/0562\/1021\/files\/present2socialgracesimage.png?v=1700446999"},{"product_id":"pickleball-rackets-crossed-1","title":"Pickleball Rackets Striped Crossed Mini","description":"\u003cp data-pm-slice=\"1 1 []\"\u003eOur Pickleball Rackets Striped Crossed is a perfect accent for a name or monogram.  Hand drawn and digitized in a mini fill stitch.  \u003cspan data-mce-fragment=\"1\"\u003eUse this embroidery design to embellish garments, linens, accessories, and more. Perfect for sport gear, pickleball monograms, or sport themed celebrations. Each\u003c\/span\u003e design has been tested for quality stitching. This design also comes in a larger size as well as applique styles (in our other listings).\u003c\/p\u003e\n\u003cp data-pm-slice=\"1 1 []\"\u003eWHAT'S INCLUDED:\u003cbr\u003e◾ Pickleball Paddles Striped Mini Fill Machine Embroidery Design includes the following sizes:\u003cbr\u003e      1 inch (1229 stitches)\u003cbr\u003e      1.25 inch  (1653 stitches)\u003cbr\u003e      1.5 inch (2501 stitches)\u003cbr\u003e◾ This digital file comes in a .zip file downloadable format that includes:  PES, HUS, JEF, EXP, XXX, VP3, and DST.\u003c\/p\u003e\n\u003cp\u003eTHIS IS A DIGITAL PRODUCT. You must own an embroidery machine and know how to unzip your files and transfer them to your machine in order for the design\/s to stitch out. This is NOT a finished product.\u003c\/p\u003e\n\u003cp\u003e*Fonts or additional designs pictured are not included*\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eBy purchasing this listing, you are agreeing to the following terms: \u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eThis is a DIGITAL embroidery design available for immediate download intended for use with an embroidery\/applique machine. This is not a patch.\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eDue to the digital nature and instant downloads of purchased items; returns, refunds, exchanges or cancellations are not available. \u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eFor best results, resizing is not recommended. We cannot guarantee results when a design has been modified in a software or when using non-traditional hooping methods. \u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eYou may not copy, share, or sell my digital designs in part or entirety. \u003cspan data-mce-fragment=\"1\"\u003eResale of physical merchandise created by using this\/these designs is permitted up to 49 times.  Commercial license listing is required for embroidering on 50+ items. \u003c\/span\u003e\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eIf there is a problem with an item you downloaded, please let me know right away and I will do my best to fix it.\u003c\/p\u003e\n\u003cp\u003e\u003cbr\u003e**If you forget to use a sale or coupon code, I am not able to issue a refund for the discount.\u003cbr\u003e\u003cbr\u003e\u003c\/p\u003e","brand":"MKB Embroidery Designs","offers":[{"title":"Default Title","offer_id":46691474080029,"sku":null,"price":4.0,"currency_code":"USD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0828\/0562\/1021\/files\/pickleballministripedstacyssouthernstyleImage.png?v=1695948779"},{"product_id":"candy-cane-with-a-bow","title":"Candy Cane with a Bow Mini","description":"\u003cp data-pm-slice=\"1 1 []\"\u003eOur Mini Candy Cane with a Bow is a perfect accent for a name or monogram.  Hand drawn and digitized in a fill stitch.  The design comes in three sizes: 1, 1.25, and 1.5 inch. \u003cspan data-mce-fragment=\"1\"\u003eUse this mini embroidery design to embellish garments such as t-shirts, dresses, collars, onesies, pullovers, linens, accessories, and more. Perfect for Christmas and holiday festivities, or any winter themed monograms. \u003c\/span\u003e Each design has been tested for quality stitching.\u003c\/p\u003e\n\u003cp\u003eTHIS IS A DIGITAL PRODUCT. You must own an embroidery machine and know how to unzip your files and transfer them to your machine in order for the design\/s to stitch out. This is NOT a finished product.\u003c\/p\u003e\n\u003cp\u003e\u003cspan\u003eThis file comes in the following formats: PES, DST, HUS, JEF, EXP, XXX, VP3, BMP, and INF.\u003c\/span\u003e\u003c\/p\u003e\n\u003cp\u003e*Fonts or additional designs pictured are not included*\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eBy purchasing this listing, you are agreeing to the following terms: \u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eThis is a DIGITAL embroidery design available for immediate download intended for use with an embroidery\/applique machine. This is not a patch.\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eDue to the digital nature and instant downloads of purchased items; returns, refunds, exchanges or cancellations are not available. \u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eFor best results, resizing is not recommended. We cannot guarantee results when a design has been modified in a software or when using non-traditional hooping methods. \u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eYou may not copy, share, or sell my digital designs in part or entirety. \u003cspan data-mce-fragment=\"1\"\u003eResale of physical merchandise created by using this\/these designs is permitted up to 49 times.  Commercial license listing is required for embroidering on 50+ items. \u003c\/span\u003e\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eIf there is a problem with an item you downloaded, please let me know right away and I will do my best to fix it.\u003c\/p\u003e\n\u003cp\u003e\u003cbr\u003e**If you forget to use a sale or coupon code, I am not able to issue a refund for the discount.\u003cbr\u003e\u003cbr\u003e\u003c\/p\u003e","brand":"MKB Embroidery Designs","offers":[{"title":"Default Title","offer_id":46704243376413,"sku":null,"price":3.0,"currency_code":"USD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0828\/0562\/1021\/files\/candycanebowminidigital.png?v=1695865933"},{"product_id":"candy-canes-crossed-with-a-bow","title":"Candy Canes Crossed with a Bow Mini","description":"\u003cp data-pm-slice=\"1 1 []\"\u003eOur Mini Candy Canes Crossed with a Bow are a perfect accent for a name or monogram.  Hand drawn and digitized in a fill stitch.  The design comes in three sizes: 1, 1.25, and 1.5 inch. \u003cspan data-mce-fragment=\"1\"\u003eUse this mini embroidery design to embellish garments such as t-shirts, dresses, collars, onesies, pullovers, linens, accessories, and more. Perfect for Christmas and holiday festivities, or any winter themed monograms. \u003c\/span\u003e Each design has been tested for quality stitching.\u003c\/p\u003e\n\u003cp\u003eTHIS IS A DIGITAL PRODUCT. You must own an embroidery machine and know how to unzip your files and transfer them to your machine in order for the design\/s to stitch out. This is NOT a finished product.\u003c\/p\u003e\n\u003cp\u003e\u003cspan\u003eThis file comes in the following formats: PES, DST, HUS, JEF, EXP, XXX, VP3, BMP, and INF.\u003c\/span\u003e\u003c\/p\u003e\n\u003cp\u003e*Fonts or additional designs pictured are not included*\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eBy purchasing this listing, you are agreeing to the following terms: \u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eThis is a DIGITAL embroidery design available for immediate download intended for use with an embroidery\/applique machine. This is not a patch.\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eDue to the digital nature and instant downloads of purchased items; returns, refunds, exchanges or cancellations are not available. \u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eFor best results, resizing is not recommended. We cannot guarantee results when a design has been modified in a software or when using non-traditional hooping methods. \u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eYou may not copy, share, or sell my digital designs in part or entirety. \u003cspan data-mce-fragment=\"1\"\u003eResale of physical merchandise created by using this\/these designs is permitted up to 49 times.  Commercial license listing is required for embroidering on 50+ items. \u003c\/span\u003e\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eIf there is a problem with an item you downloaded, please let me know right away and I will do my best to fix it.\u003c\/p\u003e\n\u003cp\u003e\u003cbr\u003e**If you forget to use a sale or coupon code, I am not able to issue a refund for the discount.\u003cbr\u003e\u003cbr\u003e\u003c\/p\u003e","brand":"MKB Embroidery Designs","offers":[{"title":"Default Title","offer_id":46704243769629,"sku":null,"price":3.5,"currency_code":"USD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0828\/0562\/1021\/files\/candycanescrossedministacy_ssouthernstyleimage.png?v=1700705847"},{"product_id":"texas-mini","title":"Texas Embroidery Design, Mini Fill Stitch","description":"\u003cp data-pm-slice=\"1 1 []\"\u003eOur State of Texas Flag is a perfect accent for a name or monogram.  Hand drawn and digitized in a fill stitch.  The design comes in two sizes: .75 and 1 inch. \u003cspan data-mce-fragment=\"1\"\u003eUse this mini embroidery design to embellish garments such as t-shirts, dresses, collars, onesies, pullovers, linens, accessories, and more.  This mini fill design also works well when embellishing cocktail napkins, canvas tote bags, accessories, camp pillow cases, baby blankets, and more. Perfect for the rodeo, Go Texan Day, state fair, cocktail parties, birthdays, summer parties, engagement parties, or any Texas themed celebration.\u003c\/span\u003e Each design has been tested for quality stitching.\u003cbr\u003e\u003c\/p\u003e\n\u003cp\u003eTHIS IS A DIGITAL PRODUCT. You must own an embroidery machine and know how to unzip your files and transfer them to your machine in order for the design\/s to stitch out. This is NOT a finished product.\u003c\/p\u003e\n\u003cp\u003e\u003cspan\u003eThis file comes in the following formats: PES, DST, HUS, JEF, EXP, XXX, VP3, BMP, and INF.\u003c\/span\u003e\u003c\/p\u003e\n\u003cp\u003e*Fonts or additional designs pictured are not included*\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eBy purchasing this listing, you are agreeing to the following terms: \u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eThis is a DIGITAL embroidery design available for immediate download intended for use with an embroidery\/applique machine. This is not a patch.\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eDue to the digital nature and instant downloads of purchased items; returns, refunds, exchanges or cancellations are not available. \u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eFor best results, resizing is not recommended. We cannot guarantee results when a design has been modified in a software or when using non-traditional hooping methods. \u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eYou may not copy, share, or sell my digital designs in part or entirety. \u003cspan data-mce-fragment=\"1\"\u003eResale of physical merchandise created by using this\/these designs is permitted up to 49 times.  Commercial license listing is required for embroidering on 50+ items. \u003c\/span\u003e\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eIf there is a problem with an item you downloaded, please let me know right away and I will do my best to fix it.\u003c\/p\u003e\n\u003cp\u003e\u003cbr\u003e**If you forget to use a sale or coupon code, I am not able to issue a refund for the discount.\u003cbr\u003e\u003cbr\u003e\u003c\/p\u003e","brand":"MKB Embroidery Designs","offers":[{"title":"Default Title","offer_id":46704943792413,"sku":null,"price":3.5,"currency_code":"USD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0828\/0562\/1021\/files\/texasminimkbimage_1.png?v=1707706393"},{"product_id":"texas-flag-light-fill-mini","title":"Texas Flag Light Fill Mini Embroidery Design","description":"\u003cp\u003eThe mini Texas flag is a three color light fill \/ sketch stitch embroidery design. The quick stitch flag is denser than a sketch but lighter than a true fill. Use this quick stitch Texas embroidery design to embellish garments such as t-shirts, bodysuits, golf shirts, tees, sweatshirts, and dresses.  This mini light fill design also works well when embellishing cocktail napkins, canvas tote bags, accessories, camp pillow cases, and more.  Perfect for rodeo, Go Texan Day, state fairs, cocktail parties, engagement parties, hostess gifts, or any Texas themed celebration.  The Texas Flag mini light fill Machine Embroidery Design includes three sizes.  Each design has been tested for quality stitching. (see our other listing for the true fill version)\u003c\/p\u003e\n\u003cp\u003eFind the Texas Fill Stitch Version here: \u003cspan\u003ehttps:\/\/mkbembroiderydesigns.com\/products\/texas-flag-mini?utm_source=copyToPasteBoard\u0026amp;utm_medium=product-links\u0026amp;utm_content=web\u003c\/span\u003e\u003c\/p\u003e\n\u003cp\u003eWHAT'S INCLUDED:\u003cbr\u003e◾ Texas Flag Mini Light Fill\/Sketch Stitch Machine Embroidery Design includes the following sizes: \u003cbr\u003e    1 inch (838 stitches)\u003cbr\u003e    1.25 inch (1150 stitches)\u003cbr\u003e    1.5 inch (1525 stitches)\u003c\/p\u003e\n\u003cp\u003e◾ This digital file comes in a .zip file downloadable format that includes:  PES, HUS, JEF, EXP, XXX, VP3, and DST.\u003c\/p\u003e\n\u003cp\u003eTHIS IS A DIGITAL PRODUCT. You must own an embroidery machine and know how to unzip your files and transfer them to your machine in order for the design\/s to stitch out. This is NOT a finished product.\u003c\/p\u003e\n\u003cp\u003e*Fonts or additional designs pictured are not included*\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eBy purchasing this listing, you are agreeing to the following terms: \u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eThis is a DIGITAL embroidery design available for immediate download intended for use with an embroidery\/applique machine. This is not a patch.\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eDue to the digital nature and instant downloads of purchased items; returns, refunds, exchanges or cancellations are not available. \u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eFor best results, resizing is not recommended. We cannot guarantee results when a design has been modified in a software or when using non-traditional hooping methods. \u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eYou may not copy, share, or sell my digital designs in part or entirety. \u003cspan data-mce-fragment=\"1\"\u003eResale of physical merchandise created by using this\/these designs is permitted up to 49 times.  Commercial license listing is required for embroidering on 50+ items. \u003c\/span\u003e\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eIf there is a problem with an item you downloaded, please let me know right away and I will do my best to fix it.\u003c\/p\u003e\n\u003cp\u003e\u003cbr\u003e**If you forget to use a sale or coupon code, I am not able to issue a refund for the discount.\u003cbr\u003e\u003cbr\u003e\u003c\/p\u003e","brand":"MKB Embroidery Designs","offers":[{"title":"Default Title","offer_id":46705100587293,"sku":null,"price":4.5,"currency_code":"USD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0828\/0562\/1021\/files\/texas_flag_mini_sketch_1.5_inch_monogram_sample_image.png?v=1725903989"},{"product_id":"texas-flag-mini","title":"Texas Flag Mini Fill Stitch Machine Embroidery Design","description":"\u003cp data-pm-slice=\"1 1 []\"\u003eThe mini Texas flag is a three color fill stitch embroidery design. There are two files attached: one flag set has a sketch stitch star and the other set has a satin stitch star. Use this mini fill flag design to embellish garments such as t-shirts, onesies, golf shirts, tees, sweatshirts, bibs, bloomers, and dresses.  This mini Texas flag embroidery design also works well when embellishing cocktail napkins, canvas tote bags, accessories, camp pillow cases, baby blankets, guest towels, and more.  Perfect for the rodeo, Go Texan Day, state fairs, cocktail parties, engagement parties, or any Texas themed celebration.  Each design has been tested for quality stitching. \u003cbr\u003e\u003c\/p\u003e\n\u003cp data-pm-slice=\"1 1 []\"\u003eFind the Light Fill\/Sketch version here: \u003cspan\u003ehttps:\/\/mkbembroiderydesigns.com\/products\/texas-flag-light-fill-mini?utm_source=copyToPasteBoard\u0026amp;utm_medium=product-links\u0026amp;utm_content=web\u003c\/span\u003e\u003c\/p\u003e\n\u003cp\u003eWHAT'S INCLUDED:\u003cbr\u003e◾ Texas Mini Fill Stitch Machine Embroidery Design includes the following sizes: \u003cbr\u003e    1 inch (1214 stitches)\u003cbr\u003e    1.25 inch (1729 stitches)\u003cbr\u003e    1.5 inch (2398 stitches)\u003c\/p\u003e\n\u003cp\u003e◾Texas Mini Fill Stitch with Satin Stitch Star v2 Machine Embroidery Design includes the following sizes:\u003cbr\u003e    1 inch (1235 stitches)\u003cbr\u003e    1.25 inch (1703 stitches)\u003cbr\u003e    1.5 inch (2353 stitches)\u003c\/p\u003e\n\u003cp\u003e◾ This digital file comes in a .zip file downloadable format that includes:  PES, HUS, JEF, EXP, XXX, VP3, and DST.\u003c\/p\u003e\n\u003cp\u003eTHIS IS A DIGITAL PRODUCT. You must own an embroidery machine and know how to unzip your files and transfer them to your machine in order for the design\/s to stitch out. This is NOT a finished product.\u003c\/p\u003e\n\u003cp\u003e*Fonts or additional designs pictured are not included*\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eBy purchasing this listing, you are agreeing to the following terms: \u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eThis is a DIGITAL embroidery design available for immediate download intended for use with an embroidery\/applique machine. This is not a patch.\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eDue to the digital nature and instant downloads of purchased items; returns, refunds, exchanges or cancellations are not available. \u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eFor best results, resizing is not recommended. We cannot guarantee results when a design has been modified in a software or when using non-traditional hooping methods. \u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eYou may not copy, share, or sell my digital designs in part or entirety. \u003cspan data-mce-fragment=\"1\"\u003eResale of physical merchandise created by using this\/these designs is permitted up to 49 times.  Commercial license listing is required for embroidering on 50+ items. \u003c\/span\u003e\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eIf there is a problem with an item you downloaded, please let me know right away and I will do my best to fix it.\u003c\/p\u003e\n\u003cp\u003e\u003cbr\u003e**If you forget to use a sale or coupon code, I am not able to issue a refund for the discount.\u003cbr\u003e\u003cbr\u003e\u003c\/p\u003e","brand":"MKB Embroidery Designs","offers":[{"title":"Default Title","offer_id":46705337827613,"sku":null,"price":4.0,"currency_code":"USD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0828\/0562\/1021\/files\/texasflagministacyssouthernstylesImage_2.png?v=1706881585"},{"product_id":"texas-waving-flag-light-fill-mini","title":"Texas Waving Flag Light Fill Mini","description":"\u003cp data-pm-slice=\"1 1 []\"\u003eOur Texas Waving Flag Mini Light Fill is a perfect accent for a name or monogram.  Hand drawn and digitized in a light fill stitch. \u003cspan data-mce-fragment=\"1\"\u003eThis quick stitch design is denser than a sketch but lighter than a fill.\u003c\/span\u003e The design comes in five sizes: 1, 1.25, 1.5 inch, 2, and 2.25 inch. \u003cspan data-mce-fragment=\"1\"\u003eUse this light fill mini embroidery design to embellish garments such as t-shirts, dresses, collars, onesies, pullovers, linens, accessories, and more.  This mini light fill design also works well when embellishing cocktail napkins, canvas tote bags, accessories, camp pillow cases, and more. Perfect for the rodeo, Go Texan Day, state fair, cocktail parties, birthdays, summer parties, engagement parties, or any Texas themed celebration.\u003c\/span\u003e Each design has been tested for quality stitching. \u003c\/p\u003e\n\u003cp\u003eTHIS IS A DIGITAL PRODUCT. You must own an embroidery machine and know how to unzip your files and transfer them to your machine in order for the design\/s to stitch out. This is NOT a finished product.\u003c\/p\u003e\n\u003cp\u003e\u003cspan\u003eThis file comes in the following formats: PES, DST, HUS, JEF, EXP, XXX, VP3, BMP, and INF.\u003c\/span\u003e\u003c\/p\u003e\n\u003cp\u003e*Fonts or additional designs pictured are not included*\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eBy purchasing this listing, you are agreeing to the following terms: \u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eThis is a DIGITAL embroidery design available for immediate download intended for use with an embroidery\/applique machine. This is not a patch.\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eDue to the digital nature and instant downloads of purchased items; returns, refunds, exchanges or cancellations are not available. \u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eFor best results, resizing is not recommended. We cannot guarantee results when a design has been modified in a software or when using non-traditional hooping methods. \u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eYou may not copy, share, or sell my digital designs in part or entirety. \u003cspan data-mce-fragment=\"1\"\u003eResale of physical merchandise created by using this\/these designs is permitted up to 49 times.  Commercial license listing is required for embroidering on 50+ items. \u003c\/span\u003e\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eIf there is a problem with an item you downloaded, please let me know right away and I will do my best to fix it.\u003c\/p\u003e\n\u003cp\u003e\u003cbr\u003e**If you forget to use a sale or coupon code, I am not able to issue a refund for the discount.\u003cbr\u003e\u003cbr\u003e\u003c\/p\u003e","brand":"MKB Embroidery Designs","offers":[{"title":"Default Title","offer_id":46705528504605,"sku":null,"price":4.5,"currency_code":"USD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0828\/0562\/1021\/files\/texaswavingflagsketchdeshlerdesignsimage.png?v=1707791005"},{"product_id":"park-city-utah-mini-embroidery-design","title":"Park City Utah Mini Embroidery Design","description":"\u003cp data-pm-slice=\"1 1 []\"\u003e\u003cspan data-mce-fragment=\"1\"\u003eThe Utah state with the heart over Park City is a two color fill stitch embroidery design. The state of Utah embroidery design also works great as a stand alone embellishment. Use this mini fill embroidery design to embellish garments such as pom hats, t-shirts, vests, jackets, tees, sweatshirts, bodysuits, golf shirts, dresses and more.  This mini fill design also works well when embellishing products such as pillow cases, zip bags, tote bags, duffel bags, blankets, guest towels, and more.  Perfect for hostess gifts, family mountain vacations, gifts, girls trip, and any summer or winter vacation themed celebration. The Park City, Utah Mini Fill Stitch Machine Embroidery Design includes one size. \u003c\/span\u003e Each design has been tested for quality stitching.\u003cbr\u003e\u003c\/p\u003e\n\u003cp\u003eTHIS IS A DIGITAL PRODUCT. You must own an embroidery machine and know how to unzip your files and transfer them to your machine in order for the design\/s to stitch out. This is NOT a finished product.\u003c\/p\u003e\n\u003cp\u003eWHAT'S INCLUDED:\u003cbr\u003e◾ Park City, Utah Mini Fill Stitch Machine Embroidery Design includes the following size:\u003cbr\u003e      1.5 (2684 stitches)\u003cbr\u003e◾ This digital file comes in a .zip file downloadable format that includes:  PES, HUS, JEF, EXP, XXX, VP3, and DST.\u003c\/p\u003e\n\u003cp\u003e*Fonts or additional designs pictured are not included*\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eBy purchasing this listing, you are agreeing to the following terms: \u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eThis is a DIGITAL embroidery design available for immediate download intended for use with an embroidery\/applique machine. This is not a patch.\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eDue to the digital nature and instant downloads of purchased items; returns, refunds, exchanges or cancellations are not available. \u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eFor best results, resizing is not recommended. We cannot guarantee results when a design has been modified in a software or when using non-traditional hooping methods. \u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eYou may not copy, share, or sell my digital designs in part or entirety. \u003cspan data-mce-fragment=\"1\"\u003eResale of physical merchandise created by using this\/these designs is permitted up to 49 times.  Commercial license listing is required for embroidering on 50+ items. \u003c\/span\u003e\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eIf there is a problem with an item you downloaded, please let me know right away and I will do my best to fix it.\u003c\/p\u003e\n\u003cp\u003e\u003cbr\u003e**If you forget to use a sale or coupon code, I am not able to issue a refund for the discount.\u003cbr\u003e\u003cbr\u003e\u003c\/p\u003e","brand":"MKB Embroidery Designs","offers":[{"title":"Default Title","offer_id":46705792647453,"sku":null,"price":2.0,"currency_code":"USD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0828\/0562\/1021\/files\/utah_heart_mini_park_city_utah_monogram_image.png?v=1725156898"},{"product_id":"crayon-mini","title":"Crayon Mini","description":"\u003cp\u003eOur Mini Crayon is a perfect accent for a name or monogram.  Hand-drawn and digitized in a light fill\/denser sketch stitch.  The design comes in five sizes: .875, 1, 1.1, 1.25, and 1.5 inch.  \u003cspan data-mce-fragment=\"1\"\u003eUse this quick stitch design to embellish garments such as t-shirts, onesies, golf shirts, pullovers, pencil bags, accessories, and more. Perfect for back to school monograms. \u003c\/span\u003e Each design has been tested for quality stitching.\u003cbr\u003e\u003c\/p\u003e\n\u003cp\u003eTHIS IS A DIGITAL PRODUCT. You must own an embroidery machine and know how to unzip your files and transfer them to your machine in order for the design\/s to stitch out. This is NOT a finished product.\u003c\/p\u003e\n\u003cp\u003e\u003cspan\u003eThis file comes in the following formats: PES, DST, HUS, JEF, EXP, XXX, VP3, BMP, and INF.\u003c\/span\u003e\u003c\/p\u003e\n\u003cp\u003e*Fonts or additional designs pictured are not included*\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eBy purchasing this listing, you are agreeing to the following terms: \u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eThis is a DIGITAL embroidery design available for immediate download intended for use with an embroidery\/applique machine. This is not a patch.\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eDue to the digital nature and instant downloads of purchased items; returns, refunds, exchanges or cancellations are not available. \u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eFor best results, resizing is not recommended. We cannot guarantee results when a design has been modified in a software or when using non-traditional hooping methods. \u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eYou may not copy, share, or sell my digital designs in part or entirety. Resale of physical merchandise created by using this\/these designs is permitted. \u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eIf there is a problem with an item you downloaded, please let me know right away and I will do my best to fix it.\u003c\/p\u003e\n\u003cp\u003e\u003cbr\u003e**If you forget to use a sale or coupon code, I am not able to issue a refund for the discount.\u003cbr\u003e\u003cbr\u003e\u003c\/p\u003e","brand":"MKB Embroidery Designs","offers":[{"title":"Default Title","offer_id":46734528282909,"sku":null,"price":4.5,"currency_code":"USD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0828\/0562\/1021\/files\/20240218_170636_1.jpg?v=1708311678"},{"product_id":"butterfly-with-hearts-mini","title":"Butterfly with Hearts Fill Stitch Embroidery Design, Mini","description":"\u003cp\u003eThe mini \u003cspan data-mce-fragment=\"1\"\u003eButterfly Hearts \u003c\/span\u003eadds an adorable accent for monograms or names. \u003cspan data-mce-fragment=\"1\"\u003e \u003c\/span\u003eHand-drawn and digitized with a fill stitch, it adds a classic touch to embroidery projects.  The design comes in three sizes to cover various embroidery project needs: 1 inch, 1.5 inch, and 2 inches. \u003cspan data-mce-fragment=\"1\"\u003e Copy and paste the design, then mirror to create two butterflies that flank a name, monogram, or single letter. This mini fill design also works well when embellishing products such as pillow cases, tote bags, duffel bags, lunch boxes, blankets, and more. Perfect for class parties, gifts, birthdays, summer vacations, or any spring or summer themed celebration. \u003c\/span\u003eEach size has been tested for quality stitching. \u003c\/p\u003e\n\u003cp\u003eTHIS IS A DIGITAL PRODUCT. You must own an embroidery machine and know how to unzip your files and transfer them to your machine in order for the design\/s to stitch out. This is NOT a finished product.\u003c\/p\u003e\n\u003cp\u003e\u003cspan\u003eThis file comes in the following formats: PES, DST, HUS, JEF, EXP, XXX, VP3, BMP, and INF.\u003c\/span\u003e\u003c\/p\u003e\n\u003cp\u003e\u003cbr data-mce-fragment=\"1\"\u003e*Fonts or additional designs pictured are not included*\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eBy purchasing this listing, you are agreeing to the following terms: \u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eThis is a DIGITAL embroidery design available for immediate download intended for use with an embroidery\/applique machine. This is not a patch.\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eDue to the digital nature and instant downloads of purchased items; returns, refunds, exchanges or cancellations are not available. \u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eFor best results, resizing is not recommended. We cannot guarantee results when a design has been modified in a software or when using non-traditional hooping methods. \u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eYou may not copy, share, or sell my digital designs in part or entirety. Resale of physical merchandise created by using this\/these designs is permitted up to 49 times.  Commercial license listing is required for embroidering on 50+ items. \u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eIf there is a problem with an item you downloaded, please let me know right away and I will do my best to fix it.\u003c\/p\u003e\n\u003cp\u003e\u003cbr\u003e**If you forget to use a sale or coupon code, I am not able to issue a refund for the discount.\u003cbr\u003e\u003cbr\u003e\u003c\/p\u003e","brand":"MKB Embroidery Designs","offers":[{"title":"Default Title","offer_id":46735481635101,"sku":null,"price":3.5,"currency_code":"USD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0828\/0562\/1021\/files\/butterflyheartminithemerrybeeimage.png?v=1696009675"},{"product_id":"pickleball-rackets-striped-crossed-larger","title":"Pickleball Rackets Striped Crossed","description":"\u003cp data-pm-slice=\"1 1 []\"\u003eOur Pickleball Rackets Striped Crossed is a perfect accent for a name or monogram.  Hand drawn and digitized in a fill stitch.  The design comes in three sizes:  2, 2.5, and 3 inch.  \u003cspan data-mce-fragment=\"1\"\u003eUse this embroidery design to embellish garments such as t-shirts, dresses,  onesies, pullovers, linens, accessories, and more. Perfect for sport gear, pickleball monograms, or sport themed celebrations. Each\u003c\/span\u003e design has been tested for quality stitching. This design also comes in a smaller size as well as applique styles (in our other listings).\u003c\/p\u003e\n\u003cp\u003eTHIS IS A DIGITAL PRODUCT. You must own an embroidery machine and know how to unzip your files and transfer them to your machine in order for the design\/s to stitch out. This is NOT a finished product.\u003c\/p\u003e\n\u003cp\u003e\u003cspan\u003eThis file comes in the following formats: PES, DST, HUS, JEF, EXP, XXX, VP3, BMP, and INF.\u003c\/span\u003e\u003c\/p\u003e\n\u003cp\u003e*Fonts or additional designs pictured are not included*\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eBy purchasing this listing, you are agreeing to the following terms: \u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eThis is a DIGITAL embroidery design available for immediate download intended for use with an embroidery\/applique machine. This is not a patch.\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eDue to the digital nature and instant downloads of purchased items; returns, refunds, exchanges or cancellations are not available. \u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eFor best results, resizing is not recommended. We cannot guarantee results when a design has been modified in a software or when using non-traditional hooping methods. \u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eYou may not copy, share, or sell my digital designs in part or entirety. \u003cspan data-mce-fragment=\"1\"\u003eResale of physical merchandise created by using this\/these designs is permitted up to 49 times.  Commercial license listing is required for embroidering on 50+ items. \u003c\/span\u003e\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eIf there is a problem with an item you downloaded, please let me know right away and I will do my best to fix it.\u003c\/p\u003e\n\u003cp\u003e\u003cbr\u003e**If you forget to use a sale or coupon code, I am not able to issue a refund for the discount.\u003cbr\u003e\u003cbr\u003e\u003c\/p\u003e","brand":"MKB Embroidery Designs","offers":[{"title":"Default Title","offer_id":46735555232029,"sku":null,"price":4.0,"currency_code":"USD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0828\/0562\/1021\/files\/pickleballstripedlargerthedeshlerimage.png?v=1697565412"},{"product_id":"pickleball-rackets-diagonal-crossed-mini","title":"Pickleball Rackets Diagonal Crossed Mini","description":"\u003cp data-pm-slice=\"1 1 []\"\u003eOur Pickleball Rackets Diagonal Crossed is a perfect accent for a name or monogram.  Hand drawn and digitized in a mini fill stitch.  The design comes in three sizes:  1, 1.25, and 1.5 inch.  \u003cspan data-mce-fragment=\"1\"\u003eUse this embroidery design to embellish garments such as t-shirts, dresses,  onesies, pullovers, linens, accessories, and more. Perfect for sport gear, pickleball monograms, or sport themed celebrations. Each\u003c\/span\u003e design has been tested for quality stitching. This design also comes in a larger size and style as well as applique styles (in our other listings).\u003c\/p\u003e\n\u003cp\u003eTHIS IS A DIGITAL PRODUCT. You must own an embroidery machine and know how to unzip your files and transfer them to your machine in order for the design\/s to stitch out. This is NOT a finished product.\u003c\/p\u003e\n\u003cp\u003e\u003cspan\u003eThis file comes in the following formats: PES, DST, HUS, JEF, EXP, XXX, VP3, BMP, and INF.\u003c\/span\u003e\u003c\/p\u003e\n\u003cp\u003e*Fonts or additional designs pictured are not included*\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eBy purchasing this listing, you are agreeing to the following terms: \u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eThis is a DIGITAL embroidery design available for immediate download intended for use with an embroidery\/applique machine. This is not a patch.\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eDue to the digital nature and instant downloads of purchased items; returns, refunds, exchanges or cancellations are not available. \u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eFor best results, resizing is not recommended. We cannot guarantee results when a design has been modified in a software or when using non-traditional hooping methods. \u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eYou may not copy, share, or sell my digital designs in part or entirety. \u003cspan data-mce-fragment=\"1\"\u003eResale of physical merchandise created by using this\/these designs is permitted up to 49 times.  Commercial license listing is required for embroidering on 50+ items. \u003c\/span\u003e\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eIf there is a problem with an item you downloaded, please let me know right away and I will do my best to fix it.\u003c\/p\u003e\n\u003cp\u003e\u003cbr\u003e**If you forget to use a sale or coupon code, I am not able to issue a refund for the discount.\u003cbr\u003e\u003cbr\u003e\u003c\/p\u003e","brand":"MKB Embroidery Designs","offers":[{"title":"Default Title","offer_id":46735804203293,"sku":null,"price":4.0,"currency_code":"USD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0828\/0562\/1021\/files\/pickleballdiagonalminisocialgracesimage.png?v=1696013606"},{"product_id":"pickleball-rackets-larger-embroidery-design","title":"Pickleball Rackets Diagonal Crossed Large Embroidery Design","description":"\u003cp data-pm-slice=\"1 1 []\"\u003eThe larger pickleball paddles with a diagonal pattern is a six color fill and satin stitch embroidery design.  Use this fill stitch embroidery design to embellish garments such as t-shirts, bodysuits, tees, golf shirts, sweatshirts, and more.  The pickleball paddles and ball embroidery design also works well when embellishing tote bags, backpacks, zip bags, guest towels, and more.  Perfect for the pickleball lover, pickleball gifts, sports gear, pickleball monograms, hostess gifts, birthdays or sport themed celebrations.  Each of our designs are tested for quality stitching.\u003c\/p\u003e\n\u003cp data-pm-slice=\"1 1 []\"\u003eWHAT'S INCLUDED:\u003cbr\u003e◾ Pickleball Paddles Diagonal Large Fill Machine Embroidery Design includes the following sizes:\u003cbr\u003e 2 inch (3680 stitches)\u003cbr\u003e 2.5 inch  (4791 stitches)\u003cbr\u003e 3 inch (6339 stitches)\u003cbr\u003e◾ This digital file comes in a .zip file downloadable format that includes:  PES, HUS, JEF, EXP, XXX, VP3, and DST.\u003c\/p\u003e\n\u003cp\u003eTHIS IS A DIGITAL PRODUCT. You must own an embroidery machine and know how to unzip your files and transfer them to your machine in order for the design\/s to stitch out. This is NOT a finished product.\u003c\/p\u003e\n\u003cp\u003e*Fonts or additional designs pictured are not included*\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eBy purchasing this listing, you are agreeing to the following terms: \u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eThis is a DIGITAL embroidery design available for immediate download intended for use with an embroidery\/applique machine. This is not a patch.\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eDue to the digital nature and instant downloads of purchased items; returns, refunds, exchanges or cancellations are not available. \u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eFor best results, resizing is not recommended. We cannot guarantee results when a design has been modified in a software or when using non-traditional hooping methods. \u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eYou may not copy, share, or sell my digital designs in part or entirety. \u003cspan data-mce-fragment=\"1\"\u003eResale of physical merchandise created by using this\/these designs is permitted up to 49 times.  Commercial license listing is required for embroidering on 50+ items. \u003c\/span\u003e\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eIf there is a problem with an item you downloaded, please let me know right away and I will do my best to fix it.\u003c\/p\u003e\n\u003cp\u003e\u003cbr\u003e**If you forget to use a sale or coupon code, I am not able to issue a refund for the discount.\u003cbr\u003e\u003cbr\u003e\u003c\/p\u003e","brand":"MKB Embroidery Designs","offers":[{"title":"Default Title","offer_id":46735888449821,"sku":null,"price":4.0,"currency_code":"USD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0828\/0562\/1021\/files\/pickleball_diagonal_mei_liu_image_2.png?v=1725144151"},{"product_id":"shamrock-mini","title":"Shamrock Mini Embroidery Design","description":"\u003cp\u003eOur mini Shamrock Fill Embroidery Design is a perfect add-on to a monogram or name.  Use this mini fill embroidery design to embellish St. Patrick's Day garments such as t-shirts, onesies, golf shirts, dresses, bibs, burp towels, and more. The Irish clover embroidery design also works great on St. Patty's Day decor such as napkins, table linens, cocktail napkins or coasters, buntings, guest towels, and more.  Perfect for St. Patrick's Day, Spring gatherings, sprucing up your bar cart, Irish brunch, Irish wedding decor, hostess gifts, or any Irish themed celebration.   The Shamrock Mini Fill Machine Embroidery Design includes four sizes. Each size has been tested for quality stitching.\u003c\/p\u003e\n\u003cp\u003eWHAT'S INCLUDED:\u003cbr\u003e◾ Shamrock Mini Fill Stitch Machine Embroidery Design\u003cbr\u003e   1 inch  (1115 stitches)\u003cbr\u003e   1.5 inch (2110 stitches)\u003cbr\u003e   2 inch  (3383 stitches)\u003cbr\u003e   2.5 inch (5004 stitches)\u003cbr\u003e◾ This digital file comes in a .zip file downloadable format that includes:  PES, HUS, JEF, EXP, XXX, VP3, and DST.\u003cbr\u003e\u003c\/p\u003e\n\u003cp\u003eTHIS IS A DIGITAL PRODUCT. You must own an embroidery machine and know how to unzip your files and transfer them to your machine in order for the design\/s to stitch out. This is NOT a finished product.\u003c\/p\u003e\n\u003cp\u003e*Fonts or additional designs pictured are not included*\u003cbr\u003e\u003cbr\u003eBy purchasing this listing, you are agreeing to the following terms: \u003cbr\u003e\u003cbr\u003eThis is a DIGITAL embroidery design available for immediate download intended for use with an embroidery\/applique machine. This is not a patch.\u003cbr\u003e\u003cbr\u003eDue to the digital nature and instant downloads of purchased items; returns, refunds, exchanges or cancellations are not available. \u003cbr\u003e\u003cbr\u003eFor best results, resizing is not recommended. We cannot guarantee results when a design has been modified in a software or when using non-traditional hooping methods. \u003cbr\u003e\u003cbr\u003eYou may not copy, share, or sell my digital designs in part or entirety. Resale of physical merchandise created by using this\/these designs is permitted up to 49 times.  Commercial license listing is required for embroidering on 50+ items. \u003cbr\u003e\u003cbr\u003eIf there is a problem with an item you downloaded, please let me know right away and I will do my best to fix it.\u003c\/p\u003e\n\u003cp\u003e\u003cbr\u003e**If you forget to use a sale or coupon code, I am not able to issue a refund for the discount.\u003cbr\u003e\u003cbr\u003e\u003c\/p\u003e","brand":"MKB Embroidery Designs","offers":[{"title":"Default Title","offer_id":46736122675485,"sku":null,"price":3.5,"currency_code":"USD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0828\/0562\/1021\/files\/shamrock_Mini_fill_1_inch_monogram_sample_image.png?v=1738527009"},{"product_id":"sun-mini","title":"Sun Mini","description":"\u003cp data-pm-slice=\"1 1 []\"\u003eOur Mini Sun is a perfect accent for a name or monogram.  Hand drawn and digitized in a fill stitch, the design comes in three sizes: 1, 1.25, and 1.5 inch.  \u003cspan data-mce-fragment=\"1\"\u003eUse this mini fill stitch design to embellish garments such as t-shirts, onesies, and pullovers.  The embroidery design also works great on tote bags, zip bags, and towels, party decor such as napkins, table linens, and more. Perfect for Spring gatherings, parties, beach or summer themed celebrations. \u003c\/span\u003eEach design has been tested for quality stitching.\u003cbr\u003e\u003c\/p\u003e\n\u003cp\u003eTHIS IS A DIGITAL PRODUCT. You must own an embroidery machine and know how to unzip your files and transfer them to your machine in order for the design\/s to stitch out. This is NOT a finished product.\u003c\/p\u003e\n\u003cp\u003e\u003cspan\u003eThis file comes in the following formats: PES, DST, HUS, JEF, EXP, XXX, VP3, BMP, and INF.\u003c\/span\u003e\u003c\/p\u003e\n\u003cp\u003e*Fonts or additional designs pictured are not included*\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eBy purchasing this listing, you are agreeing to the following terms: \u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eThis is a DIGITAL embroidery design available for immediate download intended for use with an embroidery\/applique machine. This is not a patch.\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eDue to the digital nature and instant downloads of purchased items; returns, refunds, exchanges or cancellations are not available. \u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eFor best results, resizing is not recommended. We cannot guarantee results when a design has been modified in a software or when using non-traditional hooping methods. \u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eYou may not copy, share, or sell my digital designs in part or entirety. Resale of physical merchandise created by using this\/these designs is permitted. \u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eIf there is a problem with an item you downloaded, please let me know right away and I will do my best to fix it.\u003c\/p\u003e\n\u003cp\u003e\u003cbr\u003e**If you forget to use a sale or coupon code, I am not able to issue a refund for the discount.\u003cbr\u003e\u003cbr\u003e\u003c\/p\u003e","brand":"MKB Embroidery Designs","offers":[{"title":"Default Title","offer_id":46736374432029,"sku":null,"price":3.5,"currency_code":"USD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0828\/0562\/1021\/files\/sunminisubtlysouthernimage.png?v=1696017195"},{"product_id":"winter-beanie-hat-embroidery-design","title":"Beanie Hat Mini Fill Embroidery Design, Bundle Set","description":"\u003cp data-pm-slice=\"1 1 []\"\u003eOur Winter Beanie Hat Bundle Mini Fill Stitch Embroidery Design is a perfect accent for a name or monogram.  \u003cspan data-mce-fragment=\"1\"\u003eThe beanie hat embroidery designs include a plain beanie, heart beanie, and a star beanie perfect for your winter embroidery projects. Hand drawn and digitized in a fill stitch, the design comes in two sizes and three styles: 1.5 and 2 inch. The embroidery designs also work great as stand alone embellishments. Use these mini vintage toque mini fill embroidery designs to embellish garments such as t-shirts, onesies, golf shirts, vests, jackets, sweatshirts, dresses and more. These mini fill embroidery designs also work well when embellishing products such as pillow cases, zip bags, tote bags, duffel bags, lunch boxes, blankets, and more. Perfect for any fall or winter themed celebration, winter monograms, and more. \u003c\/span\u003e Each design has been tested for quality stitching.\u003c\/p\u003e\n\u003cp\u003eTHIS IS A DIGITAL PRODUCT. You must own an embroidery machine and know how to unzip your files and transfer them to your machine in order for the design\/s to stitch out. This is NOT a finished product.\u003c\/p\u003e\n\u003cp\u003eWHAT'S INCLUDED:\u003cbr\u003e◾ Winter Beanie Hat Bundle Mini Fill Stitch Machine Embroidery Designs include the following styles and sizes:\u003cbr\u003e 1.5 inch Plain Beanie (3022 stitches)\u003cbr\u003e 1.5 inch Heart Beanie (3202 stitches)\u003cbr\u003e 1.5 inch Star Beanie (3274 stitches)\u003cbr\u003e 2 inch Plain Beanie (5012 stitches)\u003cbr\u003e 2 inch Heart Beanie ( 5232 stitches)\u003cbr\u003e 2 inch Star Beanie ( 5259 stitches)\u003cbr\u003e\u003cbr\u003e◾ This digital file comes in a .zip file downloadable format that includes: PES, HUS, JEF, EXP, XXX, VP3, and DST.\u003c\/p\u003e\n\u003cp\u003e*Fonts or additional designs pictured are not included*\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eBy purchasing this listing, you are agreeing to the following terms: \u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eThis is a DIGITAL embroidery design available for immediate download intended for use with an embroidery\/applique machine. This is not a patch.\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eDue to the digital nature and instant downloads of purchased items; returns, refunds, exchanges or cancellations are not available. \u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eFor best results, resizing is not recommended. We cannot guarantee results when a design has been modified in a software or when using non-traditional hooping methods. \u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eYou may not copy, share, or sell my digital designs in part or entirety. Resale of physical merchandise created by using this\/these designs is permitted up to 49 times.  Commercial license listing is required for embroidering on 50+ items. \u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eIf there is a problem with an item you downloaded, please let me know right away and I will do my best to fix it.\u003c\/p\u003e\n\u003cp\u003e\u003cbr\u003e**If you forget to use a sale or coupon code, I am not able to issue a refund for the discount.\u003cbr\u003e\u003cbr\u003e\u003c\/p\u003e","brand":"MKB Embroidery Designs","offers":[{"title":"Default Title","offer_id":46736490594589,"sku":null,"price":5.25,"currency_code":"USD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0828\/0562\/1021\/files\/winterbeanieheartminisubtlysouthernimage.png?v=1696018107"},{"product_id":"off-road-vintage-4x4-truck-sketch-embroidery-design","title":"Off Road Vintage 4x4 Truck Sketch Mini","description":"\u003cp\u003eOur \u003cspan data-mce-fragment=\"1\"\u003eVintage 4x4 Mini Off Road\u003c\/span\u003e embroidery design is the perfect add-on to a monogram or name. \u003cspan data-mce-fragment=\"1\"\u003eHand-drawn and digitized in a sketch stitch, it adds a classic touch to embroidery projects on golf shirts, t-shirts, onesies, zip bags, tote bags, and more. Perfect for birthdays, beach trips, summer fun, or any vintage themed festivities. This mini sketch design also comes in other styles in different listings. This Vintage 4x4 Truck Mini Sketch Machine Embroidery Design includes three size: 2, 2.5, and 3 inches.\u003c\/span\u003e\u003cspan data-mce-fragment=\"1\"\u003e \u003c\/span\u003eEach size has been tested for quality stitching. \u003cbr\u003e\u003c\/p\u003e\n\u003cp\u003eWHAT'S INCLUDED:\u003cbr\u003e◾ Vintage 4x4 Truck Mini Sketch Fill Stitch Machine Embroidery Design includes the following sizes:\u003cbr\u003e2 inches (1519 stitches)\u003cbr\u003e2.5 inches (2019 stitches)\u003cbr\u003e3 inches (2432 stitches)\u003cbr\u003e◾ This digital file comes in a .zip file downloadable format that includes: PES, HUS, JEF, EXP, XXX, VP3, and DST.\u003c\/p\u003e\n\u003cp\u003eTHIS IS A DIGITAL PRODUCT. You must own an embroidery machine and know how to unzip your files and transfer them to your machine in order for the design\/s to stitch out. This is NOT a finished product.\u003c\/p\u003e\n\u003cp\u003e*Fonts or additional designs pictured are not included*\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eBy purchasing this listing, you are agreeing to the following terms: \u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eThis is a DIGITAL embroidery design available for immediate download intended for use with an embroidery\/applique machine. This is not a patch.\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eDue to the digital nature and instant downloads of purchased items; returns, refunds, exchanges or cancellations are not available. \u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eFor best results, resizing is not recommended. We cannot guarantee results when a design has been modified in a software or when using non-traditional hooping methods. \u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eYou may not copy, share, or sell my digital designs in part or entirety. Resale of physical merchandise created by using this\/these designs is permitted up to 49 times. Commercial license listing is required for embroidering on 50+ items. \u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eIf there is a problem with an item you downloaded, please let me know right away and I will do my best to fix it.\u003c\/p\u003e\n\u003cp\u003e\u003cbr\u003e**If you forget to use a sale or coupon code, I am not able to issue a refund for the discount.\u003cbr\u003e\u003cbr\u003e\u003c\/p\u003e","brand":"MKB Embroidery Designs","offers":[{"title":"Default Title","offer_id":46736605544733,"sku":null,"price":4.5,"currency_code":"USD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0828\/0562\/1021\/files\/vnitage4x4sketchminilaurelandlilyimage_1.png?v=1709084472"},{"product_id":"pencil-mini","title":"Pencil Mini","description":"\u003cp\u003eOur Mini Pencil is a perfect accent for a back to school name or monogram.  Hand-drawn and digitized in a light fill\/denser sketch stitch.  The design comes in four sizes: .875, 1, 1.25, and 1.5 inch.  \u003cspan data-mce-fragment=\"1\"\u003eUse this quick stitch design to embellish garments such as t-shirts, onesies, golf shirts, pullovers, pencil bags, accessories, and more. Perfect for back to school monograms. \u003c\/span\u003e Each design has been tested for quality stitching.\u003cbr\u003e\u003c\/p\u003e\n\u003cp\u003eTHIS IS A DIGITAL PRODUCT. You must own an embroidery machine and know how to unzip your files and transfer them to your machine in order for the design\/s to stitch out. This is NOT a finished product.\u003c\/p\u003e\n\u003cp\u003e\u003cspan\u003eThis file comes in the following formats: PES, DST, HUS, JEF, EXP, XXX, VP3, BMP, and INF.\u003c\/span\u003e\u003c\/p\u003e\n\u003cp\u003e*Fonts or additional designs pictured are not included*\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eBy purchasing this listing, you are agreeing to the following terms: \u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eThis is a DIGITAL embroidery design available for immediate download intended for use with an embroidery\/applique machine. This is not a patch.\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eDue to the digital nature and instant downloads of purchased items; returns, refunds, exchanges or cancellations are not available. \u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eFor best results, resizing is not recommended. We cannot guarantee results when a design has been modified in a software or when using non-traditional hooping methods. \u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eYou may not copy, share, or sell my digital designs in part or entirety. Resale of physical merchandise created by using this\/these designs is permitted. \u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eIf there is a problem with an item you downloaded, please let me know right away and I will do my best to fix it.\u003c\/p\u003e\n\u003cp\u003e\u003cbr\u003e**If you forget to use a sale or coupon code, I am not able to issue a refund for the discount.\u003cbr\u003e\u003cbr\u003e\u003c\/p\u003e","brand":"MKB Embroidery Designs","offers":[{"title":"Default Title","offer_id":46736879780125,"sku":null,"price":4.5,"currency_code":"USD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0828\/0562\/1021\/files\/pencilminisketchlaurelandlilyimage.png?v=1696021185"},{"product_id":"turtle-mini","title":"Turtle Mini","description":"\u003cp\u003eThe Mini Turtle adds an adorable accent for monograms or names. \u003cspan data-mce-fragment=\"1\"\u003e \u003c\/span\u003eHand-drawn and digitized in a fill stitch, it adds a classic touch to embroidery projects.  The mini design comes in three sizes to cover various embroidery project needs: 1 inch, 1.5 inch, and 2 inches. \u003cspan data-mce-fragment=\"1\"\u003e \u003c\/span\u003eEach size has been tested for quality stitching. \u003c\/p\u003e\n\u003cp\u003eTHIS IS A DIGITAL PRODUCT. You must own an embroidery machine and know how to unzip your files and transfer them to your machine in order for the design\/s to stitch out. This is NOT a finished product.\u003c\/p\u003e\n\u003cp\u003e\u003cspan\u003eThis file comes in the following formats: PES, DST, HUS, JEF, EXP, XXX, VP3, BMP, and INF.\u003c\/span\u003e\u003c\/p\u003e\n\u003cp\u003e\u003cbr data-mce-fragment=\"1\"\u003e*Fonts or additional designs pictured are not included*\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eBy purchasing this listing, you are agreeing to the following terms: \u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eThis is a DIGITAL embroidery design available for immediate download intended for use with an embroidery\/applique machine. This is not a patch.\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eDue to the digital nature and instant downloads of purchased items; returns, refunds, exchanges or cancellations are not available. \u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eFor best results, resizing is not recommended. We cannot guarantee results when a design has been modified in a software or when using non-traditional hooping methods. \u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eYou may not copy, share, or sell my digital designs in part or entirety. Resale of physical merchandise created by using this\/these designs is permitted up to 49 times.  Commercial license listing is required for embroidering on 50+ items. \u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eIf there is a problem with an item you downloaded, please let me know right away and I will do my best to fix it.\u003c\/p\u003e\n\u003cp\u003e\u003cbr\u003e**If you forget to use a sale or coupon code, I am not able to issue a refund for the discount.\u003cbr\u003e\u003cbr\u003e\u003c\/p\u003e","brand":"MKB Embroidery Designs","offers":[{"title":"Default Title","offer_id":46736940073245,"sku":null,"price":3.5,"currency_code":"USD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0828\/0562\/1021\/files\/turtleminipurplepeaboutiqueimage.png?v=1696024693"},{"product_id":"turtle-girl-mini","title":"Turtle Embroidery Design, Girl Turtle with a Bow Machine Embroidery Design File","description":"\u003cp\u003eThe Mini Turtle with a Bow adds an adorable accent for monograms or names. \u003cspan data-mce-fragment=\"1\"\u003e \u003c\/span\u003eHand-drawn and digitized in a fill stitch, it adds a classic touch to embroidery projects.  The mini design comes in three sizes to cover various embroidery project needs: 1 inch, 1.5 inch, and 2 inches. \u003cspan data-mce-fragment=\"1\"\u003e \u003c\/span\u003eEach size has been tested for quality stitching. \u003c\/p\u003e\n\u003cp\u003eTHIS IS A DIGITAL PRODUCT. You must own an embroidery machine and know how to unzip your files and transfer them to your machine in order for the design\/s to stitch out. This is NOT a finished product.\u003c\/p\u003e\n\u003cp\u003e\u003cspan\u003eThis file comes in the following formats: PES, DST, HUS, JEF, EXP, XXX, VP3, BMP, and INF.\u003c\/span\u003e\u003c\/p\u003e\n\u003cp\u003e\u003cbr data-mce-fragment=\"1\"\u003e*Fonts or additional designs pictured are not included*\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eBy purchasing this listing, you are agreeing to the following terms: \u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eThis is a DIGITAL embroidery design available for immediate download intended for use with an embroidery\/applique machine. This is not a patch.\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eDue to the digital nature and instant downloads of purchased items; returns, refunds, exchanges or cancellations are not available. \u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eFor best results, resizing is not recommended. We cannot guarantee results when a design has been modified in a software or when using non-traditional hooping methods. \u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eYou may not copy, share, or sell my digital designs in part or entirety. Resale of physical merchandise created by using this\/these designs is permitted up to 49 times.  Commercial license listing is required for embroidering on 50+ items. \u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eIf there is a problem with an item you downloaded, please let me know right away and I will do my best to fix it.\u003c\/p\u003e\n\u003cp\u003e\u003cbr\u003e**If you forget to use a sale or coupon code, I am not able to issue a refund for the discount.\u003cbr\u003e\u003cbr\u003e\u003c\/p\u003e","brand":"MKB Embroidery Designs","offers":[{"title":"Default Title","offer_id":46737417666845,"sku":null,"price":3.5,"currency_code":"USD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0828\/0562\/1021\/files\/turtleminigirlsewclassyandsassyimage.png?v=1707947804"},{"product_id":"easter-egg-dump-truck-mini","title":"Easter Egg Dump Truck Mini Machine Embroidery Design","description":"\u003cp\u003eOur \u003cspan data-mce-fragment=\"1\"\u003eEaster Egg Dump Truck\u003c\/span\u003e is a perfect accent to an Easter monogram or name. Hand-drawn and digitized in a fill stitch.  There are three sizes to this mini design: 1.5 inch, 2 inch and 2.5 inches.  \u003cspan data-mce-fragment=\"1\"\u003eThis mini fill design also works well when embellishing Easter goodies such as Easter basket liners, tote bags, blankets, and more. Perfect for Easter birthdays, Spring gatherings, or any Easter themed celebration. \u003c\/span\u003eEach size has been tested for quality stitching.\u003cbr\u003e\u003c\/p\u003e\n\u003cp\u003eWHAT'S INCLUDED:\u003cbr\u003e◾ Easter Egg Dump Truck Mini Fill Machine Embroidery Design includes the following sizes:\u003cbr\u003e1 x 1.5 inch (2595 stitches)\u003cbr\u003e1.25 x 2 inch (3567 stitches)\u003cbr\u003e1.5 x 2.5 inch (4865 stitches)\u003cbr\u003e◾ This digital file comes in a .zip file downloadable format that includes: PES, HUS, JEF, EXP, XXX, VP3, and DST.\u003c\/p\u003e\n\u003cp\u003eTHIS IS A DIGITAL PRODUCT. You must own an embroidery machine and know how to unzip your files and transfer them to your machine in order for the design\/s to stitch out. This is NOT a finished product.\u003c\/p\u003e\n\u003cp\u003e*Fonts or additional designs pictured are not included*\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eBy purchasing this listing, you are agreeing to the following terms: \u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eThis is a DIGITAL embroidery design available for immediate download intended for use with an embroidery\/applique machine. This is not a patch.\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eDue to the digital nature and instant downloads of purchased items; returns, refunds, exchanges or cancellations are not available. \u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eFor best results, resizing is not recommended. We cannot guarantee results when a design has been modified in a software or when using non-traditional hooping methods. \u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eYou may not copy, share, or sell my digital designs in part or entirety. Resale of physical merchandise created by using this\/these designs is permitted. \u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eIf there is a problem with an item you downloaded, please let me know right away and I will do my best to fix it.\u003c\/p\u003e\n\u003cp\u003e\u003cbr\u003e**If you forget to use a sale or coupon code, I am not able to issue a refund for the discount.\u003cbr\u003e\u003cbr\u003e\u003c\/p\u003e","brand":"MKB Embroidery Designs","offers":[{"title":"Default Title","offer_id":46737442996509,"sku":null,"price":3.75,"currency_code":"USD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0828\/0562\/1021\/files\/eastereggdumptrucksimplyyoursimage_2.png?v=1709521661"},{"product_id":"balloon-trio-hearts-birthday-embroidery","title":"Balloon Trio Fill Stitch Embroidery Design, Mini Heart Embossed","description":"\u003cp\u003eOur Heart Embossed Balloon Trio with Heart Strings Mini Fill Stitch Embroidery Design adds a perfect accent for monograms or names. \u003cspan data-mce-fragment=\"1\"\u003eThe heart embossed centers of each balloon add some fun detail to the embroidery design.\u003c\/span\u003e\u003cspan data-mce-fragment=\"1\"\u003e \u003c\/span\u003eHand-drawn and digitized in a fill stitch, it adds a classic touch to embroidery projects.  The design comes in three sizes to cover various embroidery project needs: 1.5 inch, 2 inch, and 2.5 inches wide. \u003cspan data-mce-fragment=\"1\"\u003ePerfect for birthdays, birthday monograms, summer parties, Valentine's Day, engagement parties, or any celebration for a loved one!\u003c\/span\u003e\u003cspan data-mce-fragment=\"1\"\u003e \u003c\/span\u003eEach size has been tested for quality stitching. \u003c\/p\u003e\n\u003cp\u003eTHIS IS A DIGITAL PRODUCT. You must own an embroidery machine and know how to unzip your files and transfer them to your machine in order for the design\/s to stitch out. This is NOT a finished product.\u003c\/p\u003e\n\u003cp\u003eWHAT'S INCLUDED:\u003cbr\u003e◾ Heart Embossed Balloon Trio Mini Fill includes the following sizes: \u003cbr\u003e     1.5\"  (1545 Stitches)\u003cbr\u003e     2\"  (2283 Stitches)\u003cbr\u003e     2.5\" (3199 Stitches)\u003cbr\u003e◾ This digital file comes in a .zip file downloadable format that includes: PES, HUS, JEF, EXP, XXX, VP3, and DST.\u003c\/p\u003e\n\u003cp\u003e*Fonts or additional designs pictured are not included*\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eBy purchasing this listing, you are agreeing to the following terms: \u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eThis is a DIGITAL embroidery design available for immediate download intended for use with an embroidery\/applique machine. This is not a patch.\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eDue to the digital nature and instant downloads of purchased items; returns, refunds, exchanges or cancellations are not available. \u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eFor best results, resizing is not recommended. We cannot guarantee results when a design has been modified in a software or when using non-traditional hooping methods. \u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eYou may not copy, share, or sell my digital designs in part or entirety. Resale of physical merchandise created by using this\/these designs is permitted up to 49 times.  Commercial license listing is required for embroidering on 50+ items. \u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eIf there is a problem with an item you downloaded, please let me know right away and I will do my best to fix it.\u003c\/p\u003e\n\u003cp\u003e\u003cbr\u003e**If you forget to use a sale or coupon code, I am not able to issue a refund for the discount.\u003cbr\u003e\u003cbr\u003e\u003c\/p\u003e","brand":"MKB Embroidery Designs","offers":[{"title":"Default Title","offer_id":46739130679581,"sku":null,"price":3.5,"currency_code":"USD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0828\/0562\/1021\/files\/heartstringballoonsflyingbyathreadimage.png?v=1696085633"},{"product_id":"star-embossed-balloon-trio-mini-embroidery-design","title":"Balloon Trio Star Embossed Embroidery Design","description":"\u003cp\u003eThe mini star embossed balloon trio with star strings is a four color fill and bean stitch embroidery design. The star embossed centers of each balloon add some fun embroidery detail. The balloon embroidery design also works great as a stand alone embellishment.  Use this star balloon embroidery design to embellish garments such as t-shirts, bodysuits, tees, golf shirts, dresses and more.  This embroidery design also works well on tote bags, zip bags, cocktail napkins, for embellishing pillow cases, blankets, and more.  Perfect for birthdays, birthday monograms, summer parties, engagement parties, or any celebration for a loved one!  The Balloon Trio Mini Fill Machine Embroidery Design includes three sizes. Each size has been tested for quality stitching. \u003c\/p\u003e\n\u003cp\u003eTHIS IS A DIGITAL PRODUCT. You must own an embroidery machine and know how to unzip your files and transfer them to your machine in order for the design\/s to stitch out. This is NOT a finished product.\u003c\/p\u003e\n\u003cp\u003eWHAT'S INCLUDED:\u003cbr\u003e◾ Star Embossed Balloon Trio Mini Fill includes the following sizes: \u003cbr\u003e   1.5\" (1536 Stitches)\u003cbr\u003e   2\" (2252 Stitches)\u003cbr\u003e   2.5\" (3097Stitches)\u003cbr\u003e\u003cbr\u003e◾ This digital file comes in a .zip file downloadable format that includes: PES, HUS, JEF, EXP, XXX, VP3, and DST.\u003c\/p\u003e\n\u003cp\u003e*Fonts or additional designs pictured are not included*\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eBy purchasing this listing, you are agreeing to the following terms: \u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eThis is a DIGITAL embroidery design available for immediate download intended for use with an embroidery\/applique machine. This is not a patch.\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eDue to the digital nature and instant downloads of purchased items; returns, refunds, exchanges or cancellations are not available. \u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eFor best results, resizing is not recommended. We cannot guarantee results when a design has been modified in a software or when using non-traditional hooping methods. \u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eYou may not copy, share, or sell my digital designs in part or entirety. Resale of physical merchandise created by using this\/these designs is permitted up to 49 times.  Commercial license listing is required for embroidering on 50+ items. \u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eIf there is a problem with an item you downloaded, please let me know right away and I will do my best to fix it.\u003c\/p\u003e\n\u003cp\u003e\u003cbr\u003e**If you forget to use a sale or coupon code, I am not able to issue a refund for the discount.\u003cbr\u003e\u003cbr\u003e\u003c\/p\u003e","brand":"MKB Embroidery Designs","offers":[{"title":"Default Title","offer_id":46745676120349,"sku":null,"price":3.5,"currency_code":"USD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0828\/0562\/1021\/files\/balloons_star_embossed_2_inch_mongoram_sample_image.png?v=1725150681"},{"product_id":"dump-truck","title":"Dump Truck Mini Embroidery Design","description":"\u003cp\u003eThe mini\u003cspan data-mce-fragment=\"1\"\u003e fill stitch dump truck\u003c\/span\u003e is a perfect accent to a monogram or name.  \u003cspan data-mce-fragment=\"1\"\u003eUse this quick stitch mini fill design to embellish garments such as t-shirts, onesies, golf shirts, and more. This mini fill design also works well when embellishing tote bags, duffel bags, blankets, and more. Perfect for birthdays or any construction themed celebration. \u003c\/span\u003eEach size has been tested for quality stitching.\u003cbr\u003e\u003c\/p\u003e\n\u003cp\u003eWHAT'S INCLUDED:\u003cbr\u003e◾ Dump Truck Mini Fill Machine Embroidery Design includes the following sizes:\u003cbr\u003e 1.5 inch (2595 stitches)\u003cbr\u003e 2 inch  (3567 stitches)\u003cbr\u003e 2.5 inch (4865 stitches)\u003cbr\u003e◾ This digital file comes in a .zip file downloadable format that includes:  PES, HUS, JEF, EXP, XXX, VP3, and DST.\u003c\/p\u003e\n\u003cp\u003eTHIS IS A DIGITAL PRODUCT. You must own an embroidery machine and know how to unzip your files and transfer them to your machine in order for the design\/s to stitch out. This is NOT a finished product.\u003c\/p\u003e\n\u003cp\u003e\u003cspan\u003eThis file comes in the following formats: PES, DST, HUS, JEF, EXP, XXX, VP3, BMP, and INF.\u003c\/span\u003e\u003c\/p\u003e\n\u003cp\u003e*Fonts or additional designs pictured are not included*\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eBy purchasing this listing, you are agreeing to the following terms: \u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eThis is a DIGITAL embroidery design available for immediate download intended for use with an embroidery\/applique machine. This is not a patch.\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eDue to the digital nature and instant downloads of purchased items; returns, refunds, exchanges or cancellations are not available. \u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eFor best results, resizing is not recommended. We cannot guarantee results when a design has been modified in a software or when using non-traditional hooping methods.\u003cbr\u003e\u003c\/p\u003e\n\u003cp\u003eYou may not copy, share, or sell my digital designs in part or entirety.  Resale of physical merchandise created by using this\/these designs is permitted up to 49 times.  Commercial license listing is required for embroidering on 50+ items. \u003cbr\u003e \u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eIf there is a problem with an item you downloaded, please let me know right away and I will do my best to fix it.\u003c\/p\u003e\n\u003cp\u003e\u003cbr\u003e**If you forget to use a sale or coupon code, I am not able to issue a refund for the discount.\u003cbr\u003e\u003cbr\u003e\u003c\/p\u003e","brand":"MKB Embroidery Designs","offers":[{"title":"Default Title","offer_id":46745788645661,"sku":null,"price":3.75,"currency_code":"USD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0828\/0562\/1021\/files\/dump_truck_mini_kimberly_methvin_image_2.png?v=1728841966"},{"product_id":"american-flag-mini-patriotic-4th-of-july-monogram","title":"American Flag Mini Bean Stitch Embroidery Design","description":"\u003cp\u003eOur mini USA flag outline is a perfect add-on to a monogram or name.  Use this mini American flag motif outline design to embellish garments such as dresses, golf shirts, t-shirts, tees, bodysuits, and more. The patriotic embroidery design also works great on party décor such as napkins, cocktail napkins, table linens, girt towels, and more.  A quick stitch embroidery outline design and perfect for patriotic gatherings, 4th of July parties, Labor Day, July 4th, or summer themed celebrations. Each size has been tested for quality stitching.\u003c\/p\u003e\n\u003cp\u003eWHAT'S INCLUDED:\u003cbr\u003e◾ Mini Micro American Flag Outline Bean Stitch Machine Embroidery Design includes the following sizes:\u003cbr\u003e    .75\" (442 Stitches)\u003cbr\u003e    1.25\" (647 Stitches)\u003cbr\u003e    1.5\" (714 Stitches)\u003cbr\u003e◾ This digital file comes in a .zip file downloadable format that includes:  PES, HUS, JEF, EXP, XXX, VP3, and DST.\u003c\/p\u003e\n\u003cp\u003e\u003cem\u003eFonts or additional designs pictured are not included\u003c\/em\u003e\u003c\/p\u003e\n\u003cp\u003eTHIS IS A DIGITAL PRODUCT. You must own an embroidery machine and know how to unzip your files and transfer them to your machine in order for the design\/s to stitch out. This is NOT a finished product.\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eBy purchasing this listing, you are agreeing to the following terms: \u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eThis is a DIGITAL embroidery design available for immediate download intended for use with an embroidery\/applique machine. This is not a patch.\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eDue to the digital nature and instant downloads of purchased items; returns, refunds, exchanges or cancellations are not available. \u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eFor best results, resizing is not recommended. We cannot guarantee results when a design has been modified in a software or when using non-traditional hooping methods. \u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eYou may not copy, share, or sell my digital designs in part or entirety. Resale of physical merchandise created by using this\/these designs is permitted up to 49 times.  Commercial license listing is required for embroidering on 50+ items. \u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eIf there is a problem with an item you downloaded, please let me know right away and I will do my best to fix it.\u003c\/p\u003e\n\u003cp\u003e\u003cbr\u003e**If you forget to use a sale or coupon code, I am not able to issue a refund for the discount.\u003cbr\u003e\u003cbr\u003e\u003c\/p\u003e","brand":"MKB Embroidery Designs","offers":[{"title":"Default Title","offer_id":46746271547677,"sku":null,"price":3.75,"currency_code":"USD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0828\/0562\/1021\/files\/americanflagmicrosubtlysouthernimage.png?v=1696092037"},{"product_id":"easter-egg-bundle-vintage","title":"Easter Egg Bundle Vintage","description":"\u003cp\u003e \u003c\/p\u003e\n\u003cp\u003eOur \u003cspan data-mce-fragment=\"1\"\u003eVintage Egg Outline Bundle \u003c\/span\u003eembroidery design \u003cspan data-mce-fragment=\"1\"\u003e includes all four of our vintage eggs in one listing.\u003c\/span\u003e \u003cspan data-mce-fragment=\"1\"\u003eHand-drawn and digitized in a bean stitch, it adds a classic touch to monograms. \u003c\/span\u003eEach vintage egg outline is a quick stitch, single color perfect add-on embellishment to a monogram or name.  The bean stitch embroidery design also works great as a stand alone embellishment. Please note, these designs are perfect for lightweight products such as linens, cocktail napkins, linen guest towels, peter pan collars, and lightweight cottons, etc.  THESE DESIGNS ARE NOT MEANT FOR THICK OR HEAVYWEIGHT FABRICS WITH A KNAP\/LOOPS.  Perfect for Easter birthdays, Spring gatherings, or any Easter themed festivities.  The Vintage Egg Outline Bundle Machine Embroidery Design includes the Egg Knot Loop Motif, Egg Star Motif, Egg Flower Loop, and the Egg Knot Vintage Egg Outlines, Bean Stitch Machine Embroidery Design in three sizes for a total of 12 design files in the following sizes: .75, 1.5, and 2 inch. All\u003cspan data-mce-fragment=\"1\"\u003e designs\u003c\/span\u003e have been tested for quality stitching. \u003cbr\u003e\u003c\/p\u003e\n\u003cp\u003e** Please make sure you have an understanding of how to stitch SHADOW WORK prior to purchasing.**\u003c\/p\u003e\n\u003cp\u003eTHIS IS A DIGITAL PRODUCT. You must own an embroidery machine and know how to unzip your files and transfer them to your machine in order for the design\/s to stitch out. This is NOT a finished product.\u003c\/p\u003e\n\u003cp\u003e\u003cspan\u003eThis file comes in the following formats: PES, DST, HUS, JEF, EXP, XXX, VP3, BMP, and INF.\u003c\/span\u003e\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003e*Fonts or additional designs pictured are not included*\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eBy purchasing this listing, you are agreeing to the following terms: \u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eThis is a DIGITAL embroidery design available for immediate download intended for use with an embroidery\/applique machine. This is not a patch.\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eDue to the digital nature and instant downloads of purchased items; returns, refunds, exchanges or cancellations are not available. \u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eFor best results, resizing is not recommended. We cannot guarantee results when a design has been modified in a software or when using non-traditional hooping methods. \u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eYou may not copy, share, or sell my digital designs in part or entirety. Resale of physical merchandise created by using this\/these designs is permitted. \u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eIf there is a problem with an item you downloaded, please let me know right away and I will do my best to fix it.\u003c\/p\u003e\n\u003cp\u003e\u003cbr\u003e**If you forget to use a sale or coupon code, I am not able to issue a refund for the discount.\u003cbr\u003e\u003cbr\u003e\u003c\/p\u003e","brand":"MKB Embroidery Designs","offers":[{"title":"Default Title","offer_id":46747374485789,"sku":null,"price":10.0,"currency_code":"USD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0828\/0562\/1021\/files\/eastereggvintagebundlewedoweeimage.png?v=1696099407"},{"product_id":"easter-egg-vintage-flower","title":"Easter Egg Vintage Flower Mini","description":"\u003cp\u003eOur \u003cspan data-mce-fragment=\"1\"\u003eVintage Egg Flower Loop Motif Bean Stitch Outline \u003c\/span\u003eembroidery design is a quick stitch, single color design. \u003cspan data-mce-fragment=\"1\"\u003eHand-drawn and digitized in a bean stitch, it adds a classic touch to monograms. The bean stitch embroidery design also works great as a stand alone embellishment. Please note, this design is perfect for lightweight products such as linens, cocktail napkins, linen guest towels, peter pan collars, and lightweight cottons, etc. THIS DESIGN IS NOT MEANT FOR THICK OR HEAVYWEIGHT FABRICS WITH A KNAP\/LOOPS. Perfect for Easter birthdays, Spring gatherings, or any Easter themed festivities. The Vintage Egg Flower Loop Motif Bean Stitch Outline Machine Embroidery Design includes three sizes: .75\", 1.5\", and 2\".\u003c\/span\u003e Each \u003cspan data-mce-fragment=\"1\"\u003edesign\u003c\/span\u003e has been tested for quality stitching. \u003c\/p\u003e\n\u003cp\u003eTHIS IS A DIGITAL PRODUCT. You must own an embroidery machine and know how to unzip your files and transfer them to your machine in order for the design\/s to stitch out. This is NOT a finished product.\u003c\/p\u003e\n\u003cp\u003e\u003cspan\u003eThis file comes in the following formats: PES, DST, HUS, JEF, EXP, XXX, VP3, BMP, and INF.\u003c\/span\u003e\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003e*Fonts or additional designs pictured are not included*\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eBy purchasing this listing, you are agreeing to the following terms: \u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eThis is a DIGITAL embroidery design available for immediate download intended for use with an embroidery\/applique machine. This is not a patch.\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eDue to the digital nature and instant downloads of purchased items; returns, refunds, exchanges or cancellations are not available. \u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eFor best results, resizing is not recommended. We cannot guarantee results when a design has been modified in a software or when using non-traditional hooping methods. \u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eYou may not copy, share, or sell my digital designs in part or entirety. Resale of physical merchandise created by using this\/these designs is permitted. \u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eIf there is a problem with an item you downloaded, please let me know right away and I will do my best to fix it.\u003c\/p\u003e\n\u003cp\u003e\u003cbr\u003e**If you forget to use a sale or coupon code, I am not able to issue a refund for the discount.\u003cbr\u003e\u003cbr\u003e\u003c\/p\u003e","brand":"MKB Embroidery Designs","offers":[{"title":"Default Title","offer_id":46747437269277,"sku":null,"price":3.5,"currency_code":"USD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0828\/0562\/1021\/files\/eastereggflowerloopvintagelaurenfornierimage.png?v=1696100750"},{"product_id":"easter-egg-vintage-star","title":"Easter Egg Vintage Star Mini","description":"\u003cp\u003eOur \u003cspan data-mce-fragment=\"1\"\u003eVintage Egg Star Motif Bean Stitch Outline \u003c\/span\u003eembroidery design is a quick stitch, single color design. \u003cspan data-mce-fragment=\"1\"\u003eHand-drawn and digitized in a bean stitch, it adds a classic touch to monograms. The bean stitch embroidery design also works great as a stand alone embellishment. Please note, this design is perfect for lightweight products such as linens, cocktail napkins, linen guest towels, peter pan collars, and lightweight cottons, etc. THIS DESIGN IS NOT MEANT FOR THICK OR HEAVYWEIGHT FABRICS WITH A KNAP\/LOOPS. Perfect for Easter birthdays, Spring gatherings, or any Easter themed festivities. The Vintage Easter Egg Star Motif Bean Stitch Outline Machine Embroidery Design includes three sizes: .75\", 1.5\", and 2\".\u003c\/span\u003e Each \u003cspan data-mce-fragment=\"1\"\u003edesign\u003c\/span\u003e has been tested for quality stitching. \u003c\/p\u003e\n\u003cp\u003eTHIS IS A DIGITAL PRODUCT. You must own an embroidery machine and know how to unzip your files and transfer them to your machine in order for the design\/s to stitch out. This is NOT a finished product.\u003c\/p\u003e\n\u003cp\u003e\u003cspan\u003eThis file comes in the following formats: PES, DST, HUS, JEF, EXP, XXX, VP3, BMP, and INF.\u003c\/span\u003e\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003e*Fonts or additional designs pictured are not included*\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eBy purchasing this listing, you are agreeing to the following terms: \u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eThis is a DIGITAL embroidery design available for immediate download intended for use with an embroidery\/applique machine. This is not a patch.\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eDue to the digital nature and instant downloads of purchased items; returns, refunds, exchanges or cancellations are not available. \u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eFor best results, resizing is not recommended. We cannot guarantee results when a design has been modified in a software or when using non-traditional hooping methods. \u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eYou may not copy, share, or sell my digital designs in part or entirety. Resale of physical merchandise created by using this\/these designs is permitted. \u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eIf there is a problem with an item you downloaded, please let me know right away and I will do my best to fix it.\u003c\/p\u003e\n\u003cp\u003e\u003cbr\u003e**If you forget to use a sale or coupon code, I am not able to issue a refund for the discount.\u003cbr\u003e\u003cbr\u003e\u003c\/p\u003e","brand":"MKB Embroidery Designs","offers":[{"title":"Default Title","offer_id":46747564900637,"sku":null,"price":3.5,"currency_code":"USD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0828\/0562\/1021\/files\/eastereggstarvintagevioletamethystboutiqueimage_1.png?v=1696101774"},{"product_id":"easter-egg-vintage-knot","title":"Easter Egg Vintage Knot Mini","description":"\u003cp\u003eOur \u003cspan data-mce-fragment=\"1\"\u003eVintage Egg Knot Motif Bean Stitch Outline \u003c\/span\u003eembroidery design is a quick stitch, single color design. \u003cspan data-mce-fragment=\"1\"\u003eHand-drawn and digitized in a bean stitch, it adds a classic touch to monograms. The bean stitch embroidery design also works great as a stand alone embellishment. Please note, this design is perfect for lightweight products such as linens, cocktail napkins, linen guest towels, peter pan collars, and lightweight cottons, etc. THIS DESIGN IS NOT MEANT FOR THICK OR HEAVYWEIGHT FABRICS WITH A KNAP\/LOOPS. Perfect for Easter birthdays, Spring gatherings, or any Easter themed festivities. The Vintage Easter Egg Knot Motif Bean Stitch Outline Machine Embroidery Design includes three sizes: .75\", 1.5\", and 2\".\u003c\/span\u003e Each \u003cspan data-mce-fragment=\"1\"\u003edesign\u003c\/span\u003e has been tested for quality stitching. \u003c\/p\u003e\n\u003cp\u003eTHIS IS A DIGITAL PRODUCT. You must own an embroidery machine and know how to unzip your files and transfer them to your machine in order for the design\/s to stitch out. This is NOT a finished product.\u003c\/p\u003e\n\u003cp\u003e\u003cspan\u003eThis file comes in the following formats: PES, DST, HUS, JEF, EXP, XXX, VP3, BMP, and INF.\u003c\/span\u003e\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003e*Fonts or additional designs pictured are not included*\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eBy purchasing this listing, you are agreeing to the following terms: \u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eThis is a DIGITAL embroidery design available for immediate download intended for use with an embroidery\/applique machine. This is not a patch.\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eDue to the digital nature and instant downloads of purchased items; returns, refunds, exchanges or cancellations are not available. \u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eFor best results, resizing is not recommended. We cannot guarantee results when a design has been modified in a software or when using non-traditional hooping methods. \u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eYou may not copy, share, or sell my digital designs in part or entirety. Resale of physical merchandise created by using this\/these designs is permitted. \u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eIf there is a problem with an item you downloaded, please let me know right away and I will do my best to fix it.\u003c\/p\u003e\n\u003cp\u003e\u003cbr\u003e**If you forget to use a sale or coupon code, I am not able to issue a refund for the discount.\u003cbr\u003e\u003cbr\u003e\u003c\/p\u003e","brand":"MKB Embroidery Designs","offers":[{"title":"Default Title","offer_id":46747616411933,"sku":null,"price":3.5,"currency_code":"USD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0828\/0562\/1021\/files\/eastereggknotvintagecajunpeachkidsimage.png?v=1696102680"},{"product_id":"easter-egg-vintage-knot-loop","title":"Easter Egg Vintage Knot Loop Mini","description":"\u003cp\u003eOur \u003cspan data-mce-fragment=\"1\"\u003eVintage Egg Knot Loop Motif Bean Stitch Outline \u003c\/span\u003eembroidery design is a quick stitch, single color design. \u003cspan data-mce-fragment=\"1\"\u003eHand-drawn and digitized in a bean stitch, it adds a classic touch to monograms. The bean stitch embroidery design also works great as a stand alone embellishment. Please note, this design is perfect for lightweight products such as linens, cocktail napkins, linen guest towels, peter pan collars, and lightweight cottons, etc. THIS DESIGN IS NOT MEANT FOR THICK OR HEAVYWEIGHT FABRICS WITH A KNAP\/LOOPS. Perfect for Easter birthdays, Spring gatherings, or any Easter themed festivities. The Vintage Easter Egg Knot Loop Motif Bean Stitch Outline Machine Embroidery Design includes three sizes: .75\", 1.5\", and 2\".\u003c\/span\u003e Each \u003cspan data-mce-fragment=\"1\"\u003edesign\u003c\/span\u003e has been tested for quality stitching. \u003c\/p\u003e\n\u003cp\u003eTHIS IS A DIGITAL PRODUCT. You must own an embroidery machine and know how to unzip your files and transfer them to your machine in order for the design\/s to stitch out. This is NOT a finished product.\u003c\/p\u003e\n\u003cp\u003e\u003cspan\u003eThis file comes in the following formats: PES, DST, HUS, JEF, EXP, XXX, VP3, BMP, and INF.\u003c\/span\u003e\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003e*Fonts or additional designs pictured are not included*\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eBy purchasing this listing, you are agreeing to the following terms: \u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eThis is a DIGITAL embroidery design available for immediate download intended for use with an embroidery\/applique machine. This is not a patch.\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eDue to the digital nature and instant downloads of purchased items; returns, refunds, exchanges or cancellations are not available. \u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eFor best results, resizing is not recommended. We cannot guarantee results when a design has been modified in a software or when using non-traditional hooping methods. \u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eYou may not copy, share, or sell my digital designs in part or entirety. Resale of physical merchandise created by using this\/these designs is permitted. \u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eIf there is a problem with an item you downloaded, please let me know right away and I will do my best to fix it.\u003c\/p\u003e\n\u003cp\u003e\u003cbr\u003e**If you forget to use a sale or coupon code, I am not able to issue a refund for the discount.\u003cbr\u003e\u003cbr\u003e\u003c\/p\u003e","brand":"MKB Embroidery Designs","offers":[{"title":"Default Title","offer_id":46747645411613,"sku":null,"price":3.5,"currency_code":"USD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0828\/0562\/1021\/files\/eastereggknotloopvintagelaurenfournierimage.png?v=1696102968"},{"product_id":"lacrosse-sticks","title":"Lacrosse Sticks Mini","description":"\u003cp data-pm-slice=\"1 1 []\"\u003e\u003cspan data-mce-fragment=\"1\"\u003eThe mini lacrosse sticks are a two color satin stitch embroidery design.   The perfect add-on to a sport monogram or name.  The lacrosse embroidery design also works great as a stand alone embellishment.  Use this quick stitch mini lacrosse sticks embroidery design to embellish garments such as t-shirts, bodysuits, golf shirts, tees, pullovers, and more.  This mini sport embroidery design also works well when embellishing tote bags, backpacks, zip bags, and more.  Perfect for sport gear, lacrosse monograms, birthdays or any sport themed celebration. Each\u003c\/span\u003e design has been tested for quality stitching.\u003cbr\u003e\u003c\/p\u003e\n\u003cp data-pm-slice=\"1 1 []\"\u003eWHAT'S INCLUDED:\u003cbr\u003e◾ Lacrosse Sticks Mini Fill Machine Embroidery Design includes the following sizes:\u003cbr\u003e .75 inch (661 stitches)\u003cbr\u003e 1 inch (833 stitches)\u003cbr\u003e 1.25 inch  (1232 stitches)\u003cbr\u003e 1.5 inch (1360 stitches)\u003cbr\u003e◾ This digital file comes in a .zip file downloadable format that includes:  PES, HUS, JEF, EXP, XXX, VP3, and DST.\u003c\/p\u003e\n\u003cp\u003eTHIS IS A DIGITAL PRODUCT. You must own an embroidery machine and know how to unzip your files and transfer them to your machine in order for the design\/s to stitch out. This is NOT a finished product.\u003c\/p\u003e\n\u003cp\u003e*Fonts or additional designs pictured are not included*\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eBy purchasing this listing, you are agreeing to the following terms: \u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eThis is a DIGITAL embroidery design available for immediate download intended for use with an embroidery\/applique machine. This is not a patch.\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eDue to the digital nature and instant downloads of purchased items; returns, refunds, exchanges or cancellations are not available. \u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eFor best results, resizing is not recommended. We cannot guarantee results when a design has been modified in a software or when using non-traditional hooping methods. \u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eYou may not copy, share, or sell my digital designs in part or entirety. \u003cspan data-mce-fragment=\"1\"\u003eResale of physical merchandise created by using this\/these designs is permitted up to 49 times.  Commercial license listing is required for embroidering on 50+ items. \u003c\/span\u003e\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eIf there is a problem with an item you downloaded, please let me know right away and I will do my best to fix it.\u003c\/p\u003e\n\u003cp\u003e\u003cbr\u003e**If you forget to use a sale or coupon code, I am not able to issue a refund for the discount.\u003cbr\u003e\u003cbr\u003e\u003c\/p\u003e","brand":"MKB Embroidery Designs","offers":[{"title":"Default Title","offer_id":46747679228189,"sku":null,"price":3.5,"currency_code":"USD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0828\/0562\/1021\/files\/lacrosse_mini_mkb2_image.png?v=1730119648"},{"product_id":"valentine-dump-truck","title":"Valentine Dump Truck Mini","description":"\u003cp\u003eOur Mini Valentine Dump Truck embroidery design is a classic add-on to a monogram or name. \u003cspan data-mce-fragment=\"1\"\u003eThe embroidery design also works great as a stand alone embellishment. \u003c\/span\u003e \u003cspan data-mce-fragment=\"1\"\u003eHand-drawn and digitized in a fill stitch, it adds a classic touch to embroidery projects. Use this embroidery design to embellish garments such as t-shirts, onesies, and more.  This design also works well when embellishing Valentine goodies such as tote bags, blankets, and more.  Perfect for Valentine birthdays, get well gifts, or any heart themed festivities. This Mini Valentine Dump Truck Machine Embroidery Design includes three sizes:  1.5, 2, 2.5 inch. \u003c\/span\u003eEach size has been tested for quality stitching. \u003cbr\u003e\u003c\/p\u003e\n\u003cp\u003eTHIS IS A DIGITAL PRODUCT. You must own an embroidery machine and know how to unzip your files and transfer them to your machine in order for the design\/s to stitch out. This is NOT a finished product.\u003c\/p\u003e\n\u003cp\u003e\u003cspan\u003eThis file comes in the following formats: PES, DST, HUS, JEF, EXP, XXX, VP3, BMP, and INF.\u003c\/span\u003e\u003c\/p\u003e\n\u003cp\u003e\u003cbr data-mce-fragment=\"1\"\u003e*Fonts or additional designs pictured are not included*\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eBy purchasing this listing, you are agreeing to the following terms: \u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eThis is a DIGITAL embroidery design available for immediate download intended for use with an embroidery\/applique machine. This is not a patch.\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eDue to the digital nature and instant downloads of purchased items; returns, refunds, exchanges or cancellations are not available. \u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eFor best results, resizing is not recommended. We cannot guarantee results when a design has been modified in a software or when using non-traditional hooping methods. \u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eYou may not copy, share, or sell my digital designs in part or entirety. \u003cspan data-mce-fragment=\"1\"\u003eResale of physical merchandise created by using this\/these designs is permitted up to 49 times.  Please purchase our Commercial License when embroidering 50+ items for resale.\u003c\/span\u003e\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eIf there is a problem with an item you downloaded, please let me know right away and I will do my best to fix it.\u003c\/p\u003e\n\u003cp\u003e\u003cbr\u003e**If you forget to use a sale or coupon code, I am not able to issue a refund for the discount.\u003cbr\u003e\u003cbr\u003e\u003c\/p\u003e","brand":"MKB Embroidery Designs","offers":[{"title":"Default Title","offer_id":46748094562589,"sku":null,"price":3.75,"currency_code":"USD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0828\/0562\/1021\/files\/valentineminidumptrucksubtlysouthernimage_1.png?v=1704407331"},{"product_id":"rainbow-trio","title":"Rainbow Trio Machine Embroidery Design File","description":"\u003cp\u003eThe mini rainbow trio includes a four color ombre style and a single color quick stitch style chain stitch machine embroidery design.  Use this classic mini rainbow design to embellish garments such as t-shirts, bodysuits, tees, dresses, and more. The rainbow embroidery design also works great on burp towels, bibs, and canvas zip bags. The four inch size works great with a half inch embroidery font for a cute monogram inside the rainbow arch! The chain stitch rainbow design includes six files.\u003c\/p\u003e\n\u003cp\u003eWHAT'S INCLUDED:\u003cbr\u003e◾Rainbow Trio Chain Stitch Machine Embroidery Design includes the following sizes:\u003cbr\u003e     2.5 inch ombre (1240 stitches) and single color (1291 stitches)\u003cbr\u003e     3 inch ombre (1723 stitches) and single color (1831 stitches)\u003cbr\u003e     4 inch ombre (2401 stitches) and single color (2578 stitches)\u003c\/p\u003e\n\u003cp\u003e◾ This digital file comes in a .zip file downloadable format that includes:  PES, HUS, JEF, EXP, XXX, VP3, and DST.\u003cbr\u003e\u003c\/p\u003e\n\u003cp\u003e*Fonts or additional designs pictured are not included*\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eBy purchasing this listing, you are agreeing to the following terms: \u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eThis is a DIGITAL embroidery design available for immediate download intended for use with an embroidery\/applique machine. This is not a patch.\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eDue to the digital nature and instant downloads of purchased items; returns, refunds, exchanges or cancellations are not available. \u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eFor best results, resizing is not recommended. We cannot guarantee results when a design has been modified in a software or when using non-traditional hooping methods. \u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eYou may not copy, share, or sell my digital designs in part or entirety. Resale of physical merchandise created by using this\/these designs is permitted up to 49 times. Commercial license listing is required for embroidering on 50+ items. \u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eIf there is a problem with an item you downloaded, please let me know right away and I will do my best to fix it.\u003c\/p\u003e\n\u003cp\u003e\u003cbr\u003e**If you forget to use a sale or coupon code, I am not able to issue a refund for the discount.\u003c\/p\u003e","brand":"MKB Embroidery Designs","offers":[{"title":"Default Title","offer_id":46748177269021,"sku":null,"price":4.5,"currency_code":"USD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0828\/0562\/1021\/files\/rainbow_trio_4_inch_mkb_3_image.png?v=1723232938"},{"product_id":"balloon-trio-star-mini-embroidery","title":"Balloon Trio Fill Stitch Embroidery Design, Mini Star Strings","description":"\u003cp\u003eOur Balloon Trio with Star Strings Mini fill stitch embroidery design adds a perfect accent for monograms or names. Hand-drawn and digitized with a fill stitch, it adds a classic touch to embroidery projects.  The balloon embroidery design comes in three sizes to cover various embroidery project needs: 1.5 inch, 2 inch, and 2.5 inches wide. \u003cspan data-mce-fragment=\"1\"\u003ePerfect for birthdays, birthday monograms, summer parties, or any celebration for a loved one!\u003c\/span\u003e\u003cspan data-mce-fragment=\"1\"\u003e \u003c\/span\u003eEach size has been tested for quality stitching. \u003c\/p\u003e\n\u003cp\u003eTHIS IS A DIGITAL PRODUCT. You must own an embroidery machine and know how to unzip your files and transfer them to your machine in order for the design\/s to stitch out. This is NOT a finished product.\u003c\/p\u003e\n\u003cp\u003eWHAT'S INCLUDED:\u003cbr\u003e◾ Star String Balloon Trio Mini Fill includes the following sizes: \u003cbr\u003e 1.5\" x 1\" (1306 Stitches)\u003cbr\u003e 2\" x 1.5\" (2010Stitches)\u003cbr\u003e 2.5\" x 2\" (2771 Stitches)\u003cbr\u003e\u003cbr\u003e◾ This digital file comes in a .zip file downloadable format that includes: PES, HUS, JEF, EXP, XXX, VP3, and DST.\u003c\/p\u003e\n\u003cp\u003e*Fonts or additional designs pictured are not included*\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eBy purchasing this listing, you are agreeing to the following terms: \u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eThis is a DIGITAL embroidery design available for immediate download intended for use with an embroidery\/applique machine. This is not a patch.\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eDue to the digital nature and instant downloads of purchased items; returns, refunds, exchanges or cancellations are not available. \u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eFor best results, resizing is not recommended. We cannot guarantee results when a design has been modified in a software or when using non-traditional hooping methods. \u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eYou may not copy, share, or sell my digital designs in part or entirety. Resale of physical merchandise created by using this\/these designs is permitted up to 49 times.  Commercial license listing is required for embroidering on 50+ items. \u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eIf there is a problem with an item you downloaded, please let me know right away and I will do my best to fix it.\u003c\/p\u003e\n\u003cp\u003e\u003cbr\u003e**If you forget to use a sale or coupon code, I am not able to issue a refund for the discount.\u003cbr\u003e\u003cbr\u003e\u003c\/p\u003e","brand":"MKB Embroidery Designs","offers":[{"title":"Default Title","offer_id":46748350546205,"sku":null,"price":3.5,"currency_code":"USD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0828\/0562\/1021\/files\/BalloonTrioStarstringsaveryscottembroideryimage.png?v=1696119709"},{"product_id":"dump-truck-sketch-mini","title":"Dump Truck Sketch Mini","description":"\u003cp\u003eOur\u003cspan data-mce-fragment=\"1\"\u003e Dump Truck\u003c\/span\u003e Mini Sketch machine embroidery design is a perfect accent to a monogram or name. Hand-drawn and digitized in a sketch stitch.  There are four sizes to this sketch design: 2, 2.5, and 3 inch. \u003cspan data-mce-fragment=\"1\"\u003e Use this mini sketch stitch design to embellish garments such as t-shirts, onesies, and more. Perfect for birthdays, or any construction themed festivities. This dump truck sketch design is also available in a larger set in a different listing. \u003c\/span\u003e\u003cspan data-mce-fragment=\"1\"\u003e \u003c\/span\u003eEach size has been tested for quality stitching.\u003cbr\u003e\u003c\/p\u003e\n\u003cp\u003eTHIS IS A DIGITAL PRODUCT. You must own an embroidery machine and know how to unzip your files and transfer them to your machine in order for the design\/s to stitch out. This is NOT a finished product.\u003c\/p\u003e\n\u003cp\u003e\u003cspan\u003eThis file comes in the following formats: PES, DST, HUS, JEF, EXP, XXX, VP3, BMP, and INF.\u003c\/span\u003e\u003c\/p\u003e\n\u003cp\u003e*Fonts or additional designs pictured are not included*\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eBy purchasing this listing, you are agreeing to the following terms: \u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eThis is a DIGITAL embroidery design available for immediate download intended for use with an embroidery\/applique machine. This is not a patch.\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eDue to the digital nature and instant downloads of purchased items; returns, refunds, exchanges or cancellations are not available. \u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eFor best results, resizing is not recommended. We cannot guarantee results when a design has been modified in a software or when using non-traditional hooping methods. \u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eYou may not copy, share, or sell my digital designs in part or entirety. Resale of physical merchandise created by using this\/these designs is permitted. \u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eIf there is a problem with an item you downloaded, please let me know right away and I will do my best to fix it.\u003c\/p\u003e\n\u003cp\u003e\u003cbr\u003e**If you forget to use a sale or coupon code, I am not able to issue a refund for the discount.\u003cbr\u003e\u003cbr\u003e\u003c\/p\u003e","brand":"MKB Embroidery Designs","offers":[{"title":"Default Title","offer_id":46748574646557,"sku":null,"price":4.5,"currency_code":"USD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0828\/0562\/1021\/files\/dumptruckminisketchvioletamethystboutiqueimage.png?v=1696124785"},{"product_id":"balloon-trio-heart-sketch-stitch-embroidery-design","title":"Balloon Trio Sketch Stitch Embroidery Design, Mini Heart Strings","description":"\u003cp\u003eOur Balloon Trio with Heart Strings Sketch Embroidery Design adds a perfect accent for monograms or names. Hand-drawn and digitized with a sketch stitch, it adds a classic touch to birthday embroidery projects.  The balloon sketch stitch embroidery design comes in three sizes to cover various embroidery project needs: 1.5 inch, 2 inch, and 2.5 inches wide. \u003cspan data-mce-fragment=\"1\"\u003ePerfect for birthdays, birthday monograms, Valentine's Day, summer parties, or any celebration for a loved one!\u003c\/span\u003e\u003cspan data-mce-fragment=\"1\"\u003e \u003c\/span\u003eEach size has been tested for quality stitching. \u003c\/p\u003e\n\u003cp\u003eTHIS IS A DIGITAL PRODUCT. You must own an embroidery machine and know how to unzip your files and transfer them to your machine in order for the design\/s to stitch out. This is NOT a finished product.\u003c\/p\u003e\n\u003cp\u003eWHAT'S INCLUDED:\u003cbr\u003e◾ Heart String Balloon Trio Sketch Fill includes the following sizes: \u003cbr\u003e 1.5\" x 1\" (912 Stitches)\u003cbr\u003e 2\" x 1.5\" (1174 Stitches)\u003cbr\u003e 2.5\" x 2\" (1765 Stitches)\u003cbr\u003e◾ This digital file comes in a .zip file downloadable format that includes: PES, HUS, JEF, EXP, XXX, VP3, and DST.\u003c\/p\u003e\n\u003cp\u003e*Fonts or additional designs pictured are not included*\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eBy purchasing this listing, you are agreeing to the following terms: \u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eThis is a DIGITAL embroidery design available for immediate download intended for use with an embroidery\/applique machine. This is not a patch.\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eDue to the digital nature and instant downloads of purchased items; returns, refunds, exchanges or cancellations are not available. \u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eFor best results, resizing is not recommended. We cannot guarantee results when a design has been modified in a software or when using non-traditional hooping methods. \u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eYou may not copy, share, or sell my digital designs in part or entirety. Resale of physical merchandise created by using this\/these designs is permitted up to 49 times.  Commercial license listing is required for embroidering on 50+ items. \u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eIf there is a problem with an item you downloaded, please let me know right away and I will do my best to fix it.\u003c\/p\u003e\n\u003cp\u003e\u003cbr\u003e**If you forget to use a sale or coupon code, I am not able to issue a refund for the discount.\u003cbr\u003e\u003cbr\u003e\u003c\/p\u003e","brand":"MKB Embroidery Designs","offers":[{"title":"Default Title","offer_id":46748594438429,"sku":null,"price":4.5,"currency_code":"USD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0828\/0562\/1021\/files\/heartballoonsminisketchdigital.png?v=1696125267"}],"url":"https:\/\/mkbembroiderydesigns.com\/collections\/mini-designs.oembed?page=6","provider":"MKB Embroidery Designs","version":"1.0","type":"link"}